KEGG   Selaginella moellendorffii: SELMODRAFT_139448Help
Entry
SELMODRAFT_139448 CDS       T01496                                 

Gene name
HAG1-1
Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 519 aa AA seqDB search
MVGMHHNPSSVFGLGFSHAMESGIMPDDSRENGSQLGGGGDGGGSKGEEYDDEDEDGNDD
EGEEDEEEDGEQDDEDDQETTTSLPLQQGPLRPPALNLPVVSSVKVEAAEQKDLLSSQMA
FGNLPQPVTVTVKEESTKPTLVETIQTSGAYCAREENLKKEEDAGRIKFVCYCNDGDDQH
MIWLVGLKNIFSRQLPNMPKDYIVRLVMDRSHKSMMIVKHNQVIGGITYRPYPSQKFGEI
AFCAITADEQVKGFGTRLMNHLKKYARDEDGLTHFLTYADNNAVGYFSKQGFTKEIFLDK
EIWHGYIKDYDGGTLMECRIDPILPYIDLPAMIRLQRQAIDEKIRELSNCHIVYPGLEIL
KKDFNVPRRPLRPEDIPGLKEAGWTPDQLTTSRIRFVNSPNDGPPTRQALQGLMRSMLKL
VCDHSEAWPFREPVDAREVPDYYDIIKDPIDLKTISRRLESEQFYLTLEMFVADLKRMFG
NARVYNSPETIYFKCANRVEDFFTNKLKSCVTFLRGDAS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggtaggcatgcatcacaatccgtcttccgtgtttgggctagggttctctcatgcgatg
gaatccgggataatgccggatgatagcagggagaatgggagccagctaggtggaggaggc
gatggcggtggcagcaaaggggaggagtatgacgacgaggacgaggatgggaatgacgac
gaaggggaggaggatgaggaagaggatggagagcaagacgatgaggacgatcaggagacg
acgacgagcttgcctctgcagcaaggaccgcttcgcccgcccgcattgaatcttccagtg
gtttcgtcggtcaaggtggaagcagccgagcaaaaggatttgctatcgtcgcaaatggcc
tttggcaatttaccacagcctgtgacggtgaccgtcaaggaggaatcgaccaagcctacg
ctggtggagacgatccaaaccagtggagcgtactgtgcgcgagaggaaaatctcaagaaa
gaggaagacgctggaaggatcaagtttgtctgctactgcaatgacggtgacgaccaacat
atgatttggcttgttgggctcaagaacatcttttctcgtcagctgccaaacatgccaaag
gattacatcgtccgtttggtcatggacaggagccataagtctatgatgattgtgaagcac
aaccaagttataggcggcatcacttatcgtccgtatccaagccaaaagtttggagagata
gcattctgtgcaatcacagcggacgagcaagtaaaaggctttggcacgaggctcatgaac
cacctaaaaaagtatgctcgggacgaagacgggcttactcatttcctcacgtatgccgat
aacaatgcagtgggttacttttcaaagcagggatttaccaaggaaatatttctagataaa
gagatttggcacggatacatcaaagattatgacggtggaacattaatggaatgtaggatc
gatccaatcttaccttacatagatctcccggcgatgattagattacaacggcaggcaata
gatgagaaaattcgggagctttcaaactgccacatagtttaccctggattggaaatcctc
aagaaggacttcaatgttccacggaggcctttgagacccgaagacataccaggtctaaag
gaagctggatggacgccagaccaactgaccacttctcgtataagatttgtaaactcaccg
aatgatgggccgccaacgaggcaagcccttcagggactcatgcgttccatgttaaagctg
gtttgcgatcactcggaagcttggccgtttagagaaccggtggatgcgcgtgaggtgccg
gactactacgatataatcaaagatcccatcgatttaaaaaccatatccaggaggctggag
agcgagcaattctacttgacgctggaaatgttcgtagccgacctgaaacggatgtttggg
aacgccagggtctacaactcaccggagacgatctacttcaagtgcgcaaacagggtggaa
gacttcttcacgaacaagctcaagtcgtgcgttactttcctccggggtgatgcatcgtaa

DBGET integrated database retrieval system