KEGG   Selaginella moellendorffii: SELMODRAFT_139448Help
Entry
SELMODRAFT_139448 CDS       T01496                                 

Gene name
HAG1-1
Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SELMODRAFT_139448 (HAG1-1)
Transcription machinery [BR:smo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     SELMODRAFT_139448 (HAG1-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 519 aa AA seqDB search
MVGMHHNPSSVFGLGFSHAMESGIMPDDSRENGSQLGGGGDGGGSKGEEYDDEDEDGNDD
EGEEDEEEDGEQDDEDDQETTTSLPLQQGPLRPPALNLPVVSSVKVEAAEQKDLLSSQMA
FGNLPQPVTVTVKEESTKPTLVETIQTSGAYCAREENLKKEEDAGRIKFVCYCNDGDDQH
MIWLVGLKNIFSRQLPNMPKDYIVRLVMDRSHKSMMIVKHNQVIGGITYRPYPSQKFGEI
AFCAITADEQVKGFGTRLMNHLKKYARDEDGLTHFLTYADNNAVGYFSKQGFTKEIFLDK
EIWHGYIKDYDGGTLMECRIDPILPYIDLPAMIRLQRQAIDEKIRELSNCHIVYPGLEIL
KKDFNVPRRPLRPEDIPGLKEAGWTPDQLTTSRIRFVNSPNDGPPTRQALQGLMRSMLKL
VCDHSEAWPFREPVDAREVPDYYDIIKDPIDLKTISRRLESEQFYLTLEMFVADLKRMFG
NARVYNSPETIYFKCANRVEDFFTNKLKSCVTFLRGDAS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggtaggcatgcatcacaatccgtcttccgtgtttgggctagggttctctcatgcgatg
gaatccgggataatgccggatgatagcagggagaatgggagccagctaggtggaggaggc
gatggcggtggcagcaaaggggaggagtatgacgacgaggacgaggatgggaatgacgac
gaaggggaggaggatgaggaagaggatggagagcaagacgatgaggacgatcaggagacg
acgacgagcttgcctctgcagcaaggaccgcttcgcccgcccgcattgaatcttccagtg
gtttcgtcggtcaaggtggaagcagccgagcaaaaggatttgctatcgtcgcaaatggcc
tttggcaatttaccacagcctgtgacggtgaccgtcaaggaggaatcgaccaagcctacg
ctggtggagacgatccaaaccagtggagcgtactgtgcgcgagaggaaaatctcaagaaa
gaggaagacgctggaaggatcaagtttgtctgctactgcaatgacggtgacgaccaacat
atgatttggcttgttgggctcaagaacatcttttctcgtcagctgccaaacatgccaaag
gattacatcgtccgtttggtcatggacaggagccataagtctatgatgattgtgaagcac
aaccaagttataggcggcatcacttatcgtccgtatccaagccaaaagtttggagagata
gcattctgtgcaatcacagcggacgagcaagtaaaaggctttggcacgaggctcatgaac
cacctaaaaaagtatgctcgggacgaagacgggcttactcatttcctcacgtatgccgat
aacaatgcagtgggttacttttcaaagcagggatttaccaaggaaatatttctagataaa
gagatttggcacggatacatcaaagattatgacggtggaacattaatggaatgtaggatc
gatccaatcttaccttacatagatctcccggcgatgattagattacaacggcaggcaata
gatgagaaaattcgggagctttcaaactgccacatagtttaccctggattggaaatcctc
aagaaggacttcaatgttccacggaggcctttgagacccgaagacataccaggtctaaag
gaagctggatggacgccagaccaactgaccacttctcgtataagatttgtaaactcaccg
aatgatgggccgccaacgaggcaagcccttcagggactcatgcgttccatgttaaagctg
gtttgcgatcactcggaagcttggccgtttagagaaccggtggatgcgcgtgaggtgccg
gactactacgatataatcaaagatcccatcgatttaaaaaccatatccaggaggctggag
agcgagcaattctacttgacgctggaaatgttcgtagccgacctgaaacggatgtttggg
aacgccagggtctacaactcaccggagacgatctacttcaagtgcgcaaacagggtggaa
gacttcttcacgaacaagctcaagtcgtgcgttactttcctccggggtgatgcatcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system