KEGG   Selaginella moellendorffii: SELMODRAFT_144086Help
Entry
SELMODRAFT_144086 CDS       T01496                                 

Gene name
CHLH-1
Definition
hypothetical protein
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
smo  Selaginella moellendorffii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SELMODRAFT_144086 (CHLH-1)
Enzymes [BR:smo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SELMODRAFT_144086 (CHLH-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1335 aa AA seqDB search
MMGNGLFTQTRPDVRRIVPEARPSTTVVKVVYVVLEAQYQSSLSAAVRKLNKARNDVQFE
VVGYLVEELRDKDNYEMFCKDLSNANIFIGSLIFVEELAQKVKEALEKERERMDAVLVFP
SMPEVMRLNKLGSFAMSQLGQSKSAIAQLIRRKKKENGGRFEESMLKLVRTIPKVLKYLP
SDKAQDARKFLMSLQFWLGGSSENLENLLLMVSGSYVPSLKGKDLAYGEPVVFLDTGIWH
PLAPTMFDDVKEYLNWYGTRRDMSDSLKDPNAPIVGLILQRSHIVTGDDGHYVAVVMGLE
AKGAKVVPIFAGGLDFSMPVERFLYDPISKKPLVQSVVSLTGFALVGGPASQDHPRAVEA
LTKLDVPYLVALPLVFQTTEEWLGSTLGLHPIQVALQVALPELDGGLEPIVFSGRDSRTG
KSHALHHRVEQLCTRAVKWANLKRKSVADKKLAVTVFSFPPDKGNVGTAAYLNVFSSIFS
VLTDLKKDGYNVDGLPETAEGLIEDILHDKEAKFSSPNLNVAYKMSVREYEKLTPYAKSL
EESWGKPPGNLNSDGANLLVYGKQYGNVFIGVQPTFGYEGDPMRLLFAKSASPHHGFAAY
YTFLERIFEADAVLHFGTHGSLEFMPGKQVGMSDACFPDSLIGNIPNVYYYAANNPSEAT
IAKRRSYANTISYLTPPAENAGLYKGLKQLSELIASYQSLKDSGRGNQIVSSIISTAKQC
NLDKDVALPEEEADLNPEERDLVVGKIYGKIMEIESRLLPCGLHVIGEPPTALEAVATLV
NIAALDRPDENIYGLPGILASAVGKDMESVYRNADKGNLEDVELLKEITDTCREIISCYV
NKTTNKNGQVVNVLDKLGNFGFLNMGRKEPWLEVVYQTKFRDANQEKLRVLFDFLNECLK
LIVADNELQGLKQALEGRYVEPGPGGDPIRNPKVLPTGKNIHALDPQAIPTIAALQSAKV
VVERLLERQKLENEGKYPETIALVLWGTDNIKTYGESLAQVLWMLGVKPVPDALGRVNKI
EPVSLEELGRPRIDVVVNCSGVFRDLFINQMNLLDRAVKMVAELDEPAEQNFVRKHVLEQ
AKSLGVEVREAATRIFSNASGSYSSNVNLAVENSSWDNEKQLQDMYLTRKSFAFDSDTPG
AGMSEKRKIFEAALATADATFQNLDSSEISLTDVSHYFDSDPTKLVQSLRGDKKKPSAYI
ADTTTANAQVRTLGETVRLDARTKLLNPKWYEGMLSSGYEGVREIEKRLTNTMGWSATSG
QVDNWVYEEANTTFIEDEAMQKRLLETNPNSFRKLVATFLEANGRGYWETSDENLEKLRQ
LYAEVEDRIEGVERN
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atgatgggaaatggtctcttcactcaaaccaggcccgatgtgcgaaggatcgtcccggaa
gccaggccgagcacaacggttgtcaaggtggtctacgttgttcttgaggcacaataccag
tcctcactctccgcggcggtgaggaagctcaacaaagctagaaacgacgtccagtttgag
gtggtaggctacttggtcgaggagctcagggacaaggacaactacgagatgttttgcaag
gatctctccaacgccaacattttcataggatcgctcatatttgtcgaggagctcgcgcag
aaggtgaaagaggcgctggagaaggaaagagaaaggatggacgctgttcttgtcttcccg
tcaatgccggaggtgatgagactaaacaagctgggatccttcgccatgtcgcagctggga
cagagcaaaagtgccatcgctcagctgatacggaggaagaagaaagaaaacggcggaaga
tttgaagagtcgatgctcaagttggtcaggacaattccgaaagttctcaagtatctgcca
tccgacaaggctcaggatgcgaggaagttccttatgagcttacagttctggttaggaggc
tcgtcagagaatttagagaacttgctgctcatggtttcggggtcatacgttccaagtctc
aaggggaaggatttagcatatggagagcctgtagtctttctggacactgggatatggcat
ccgctcgctcctacgatgtttgacgacgtgaaagagtacttgaactggtacgggacgaga
agagacatgagcgacagcctgaaagatccgaatgctcccatagtcggccttattctccag
agaagtcacattgtaacgggggatgatggtcactacgtagccgttgtcatgggactggaa
gctaaaggtgccaaagtcgtgccaatattcgcaggaggactcgacttttccatgccggtg
gagaggtttttatacgatcccatctcgaagaagccacttgttcagtcggtggtgtcgcta
accggatttgcactggtcggagggcctgccagtcaagaccaccctcgagcagtggaggct
ctaacaaagctggacgtcccatatctcgtggcgcttcctcttgttttccaaaccacggaa
gaatggcttggaagcacgctgggtcttcatccaattcaggtggctcttcaagttgctttg
ccggaactagacggaggattggaaccaattgtcttctctggtcgcgacagtcggacagga
aagtcgcatgctttacaccatcgtgtggagcagctttgcacccgggctgttaagtgggcc
aatctaaagcgaaagagtgtggcagataagaaactcgcggtcacagtcttcagctttcca
ccagataaaggaaatgtgggaaccgcggcttatctcaacgtgttctcttcaatcttcagt
gttctaacggatctcaaaaaggacggctacaacgtagatggtctgccagaaacagccgag
ggcctgatcgaggacattcttcacgacaaagaagcgaagtttagcagccccaacctgaac
gtcgcatacaagatgagcgttcgagagtatgagaagctgactccgtatgccaaatctttg
gaagaaagctggggtaagccaccagggaatctaaactcagatggtgccaacttactcgtc
tacgggaagcaatatggaaacgtttttattggagtgcagccaacttttggatatgaaggc
gatcctatgagacttttgtttgcgaagtctgccagccctcaccacggttttgcggcttac
tacacgtttctcgagaggatatttgaagcggacgcagttctccactttggtactcatggc
tcgctcgagttcatgcccggaaagcaagttggaatgagcgacgcctgcttcccagacagc
ttgatcggaaacattcccaacgtttactactacgcagcaaacaatccttccgaagccact
attgccaagcggaggagctatgcaaacaccatcagctatttaacgcctccagcggagaat
gccggtctttacaaggggctgaagcagctcagcgagctcattgcatcatatcagtctctc
aaagacagcggccgaggaaaccagatcgttagcagcatcataagcacggcaaaacagtgc
aaccttgacaaagatgtggcattgccagaggaagaagccgacttaaacccggaggagagg
gacttggtggtgggaaaaatatacggaaagatcatggagattgagtcccggctattgcct
tgcggcttgcacgtcattggagagcctccgactgccttagaagctgtggcaacgctcgtc
aatattgccgctttggacaggccagacgagaacatctatggtcttcctgggattctagct
tcggccgttggtaaggatatggagagcgtttacaggaacgcagacaagggaaatctagaa
gacgtggagcttctcaaggagataactgatacgtgccgggagatcatatcttgctacgtc
aacaagacaactaacaagaacggccaagtcgtcaatgtcctcgacaagctgggaaacttt
ggctttctcaacatgggaagaaaagagccgtggcttgaggtggtataccaaacgaagttc
agggacgccaaccaggaaaagctgcgggttcttttcgattttctcaacgagtgtctcaag
ctcatcgtggcggacaacgaacttcagggacttaagcaagctctagaagggagatatgtg
gaacccggtccaggaggagatcctatcaggaatccgaaagttcttccgactggaaaaaac
atccatgcattggatccgcaagcaatcccgacgatagctgctcttcagagcgccaaagtc
gtggtggagcgcctgctggagcgtcagaagctggaaaacgagggaaagtatcccgagaca
atagctctggtgctgtggggaacggacaacatcaagacttatggagagtcgcttgctcaa
gttctatggatgcttggagtcaagccggtgccggacgccttgggacgtgttaacaagatc
gagcctgtgtcgctggaggagctagggaggccaaggatcgacgtcgtggtgaattgctcc
ggggtgtttagagacttgttcatcaaccagatgaatttgctcgatcgagcagtgaagatg
gtcgcagagctggacgagcctgccgagcaaaacttcgtccgcaagcatgtgctggagcag
gccaagagcctcggcgtggaagttcgcgaagctgcaacacgcatcttctccaacgcctcg
ggctcttactcctccaacgtcaacctggcggtggaaaactcgtcgtgggacaacgaaaag
cagctgcaggacatgtacctgacgaggaaatccttcgccttcgactccgacaccccaggc
gcggggatgagcgagaagcgcaagatcttcgaagcggctctggcaacggcagacgcgact
ttccagaacctcgactcgtcggagatctccctcacggacgtcagccactacttcgactcg
gaccccacgaaactcgtccagagcctccgaggcgacaagaagaagcccagcgcgtacatt
gccgacacaaccacggcaaacgctcaggtaagaactctcggcgaaaccgtgaggctggac
gcgagaaccaagctgctgaatccaaagtggtacgaaggcatgctgtcgagcggctacgag
ggcgtgcgcgagatcgagaagaggctgacgaacaccatggggtggagcgccacctccggc
caagtcgataactgggtctacgaggaggccaacacgacgttcatcgaggacgaggcgatg
caaaagcggctgctcgagaccaatccaaactccttccgcaagctcgtcgccacattcttg
gaagccaacggccgcggctactgggagacctcggacgagaacttggagaagctccgccag
ttatacgccgaagtggaggatcgcatcgaaggggtcgagaggaactaa

DBGET integrated database retrieval system