KEGG   Selaginella moellendorffii: SELMODRAFT_144382Help
Entry
SELMODRAFT_144382 CDS       T01496                                 

Gene name
CYP703C2_v2
Definition
(RefSeq) hypothetical protein
  KO
K20496  
laurate 7-monooxygenase [EC:1.14.13.206]
Organism
smo  Selaginella moellendorffii
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 495 aa AA seqDB search
MLGRKENRNLPPGPPGWPIIGNLMQLGPLPHRTMAGWCQKYGPLVYCRLGSTPTITASSP
QMIRELLWTQDETFASRPRTTAGKLMAYHDQNVGLAPYDAHWKLMRRICVEHLLTTRRME
GFQKSRAEEARDLVQIMFKEAKAGNTINMREHLGGYTMNVVTRMLIGKRYFGTESMGEKE
ATDFRELIHAAIVLHGVFYIPDHVPLLKWIDPNGYRRLFKKMGKRMDDYYSYIVEEHRKR
QRNGEVVDGPKDFVDVLLGLAGENSELHLNDVEIKALIQDMVVGGTDTASFTMEWFMLEM
IRNPKVMRKVQAELDSVLQKKATNKHLLEESDLASLDYLRAAVKETFRIHPVGGFLIPHE
SIRDTKVAGYHVPKGSLILINTHGLGRNAAVWDNVDEFRPERFLRPEDKVHLRDSEYRVI
PFGSGKRACPGAQLGQSMLLLGLGRLLHGFDWFPPPGTSREDIDVMEAYGLTTPPRTPLR
AVAKARLDQSFYSFH
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctgggaagaaaagagaacaggaatttgccgccaggtcctcccggctggccgatcatc
gggaacttaatgcagctcggtccccttccacacaggacaatggctggctggtgccaaaag
tatggacctctcgtctactgcaggcttggctccactccgaccatcaccgctagctcgcct
cagatgatccgggagctgctgtggactcaggacgaaactttcgcgtctcggccgagaact
actgccggaaagctcatggcttaccacgaccagaacgtcgggctggctccttatgatgct
cactggaagctgatgaggaggatttgcgtggagcacttgctgacaacgcgaaggatggaa
ggcttccagaagagcagggcggaggaagctcgcgacctggtacagattatgttcaaggag
gccaaggctgggaacaccatcaacatgagggagcacttgggaggctacaccatgaacgtg
gtgaccaggatgctgattggaaagaggtactttggaaccgagtccatgggtgagaaggag
gccaccgattttcgggagctcatacacgcggcgattgtcctgcatggagttttctacatt
ccggatcacgtacctctcctcaagtggattgatcccaacggttacaggcgcctgtttaag
aagatggggaagcgaatggacgactactatagctacattgtcgaggagcaccggaagagg
cagcgaaatggtgaagtggtcgacggtcctaaggactttgtggacgttcttctcggcctg
gctggtgagaacagcgagctgcatctcaacgacgtggagatcaaagcactgatacaggat
atggtcgtggggggcaccgataccgcgtccttcactatggagtggtttatgctcgagatg
atccggaacccgaaagtcatgcggaaagtgcaggcggagctagactcggtgctgcaaaag
aaggccaccaacaagcacctgctggaagagtcggacctggcgagcctcgactacctgaga
gcagcggtcaaggaaactttcaggattcacccggttggcggcttcctcatacctcacgag
tcgatccgggacaccaaagttgccggctaccacgtccccaaaggctcgctcatcctcatc
aacactcacggtctgggaagaaacgccgcggtgtgggacaacgtcgacgagttccggccc
gagaggttcctcaggcccgaggacaaagtccacctccgcgactccgagtaccgcgtcatt
ccatttggctccggcaagcgcgcgtgccccggtgcgcagctcgggcagtcgatgctcctc
ctcggcctgggacgacttcttcacggcttcgactggtttccaccgccgggaacgagcagg
gaagacatcgacgttatggaagcttacggcctcacaacgccgccgagaactccgttgcga
gcagtggcgaaagctcgtctggatcagagcttctactctttccattga

DBGET integrated database retrieval system