KEGG   Selaginella moellendorffii: SELMODRAFT_144382Help
Entry
SELMODRAFT_144382 CDS       T01496                                 

Gene name
CYP703C2_v2
Definition
hypothetical protein
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
smo  Selaginella moellendorffii
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    SELMODRAFT_144382 (CYP703C2_v2)
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SELMODRAFT_144382 (CYP703C2_v2)
Cytochrome P450 [BR:smo00199]
 Cytochrome P450, animal type
  CYP1 family
   SELMODRAFT_144382 (CYP703C2_v2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 495 aa AA seqDB search
MLGRKENRNLPPGPPGWPIIGNLMQLGPLPHRTMAGWCQKYGPLVYCRLGSTPTITASSP
QMIRELLWTQDETFASRPRTTAGKLMAYHDQNVGLAPYDAHWKLMRRICVEHLLTTRRME
GFQKSRAEEARDLVQIMFKEAKAGNTINMREHLGGYTMNVVTRMLIGKRYFGTESMGEKE
ATDFRELIHAAIVLHGVFYIPDHVPLLKWIDPNGYRRLFKKMGKRMDDYYSYIVEEHRKR
QRNGEVVDGPKDFVDVLLGLAGENSELHLNDVEIKALIQDMVVGGTDTASFTMEWFMLEM
IRNPKVMRKVQAELDSVLQKKATNKHLLEESDLASLDYLRAAVKETFRIHPVGGFLIPHE
SIRDTKVAGYHVPKGSLILINTHGLGRNAAVWDNVDEFRPERFLRPEDKVHLRDSEYRVI
PFGSGKRACPGAQLGQSMLLLGLGRLLHGFDWFPPPGTSREDIDVMEAYGLTTPPRTPLR
AVAKARLDQSFYSFH
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctgggaagaaaagagaacaggaatttgccgccaggtcctcccggctggccgatcatc
gggaacttaatgcagctcggtccccttccacacaggacaatggctggctggtgccaaaag
tatggacctctcgtctactgcaggcttggctccactccgaccatcaccgctagctcgcct
cagatgatccgggagctgctgtggactcaggacgaaactttcgcgtctcggccgagaact
actgccggaaagctcatggcttaccacgaccagaacgtcgggctggctccttatgatgct
cactggaagctgatgaggaggatttgcgtggagcacttgctgacaacgcgaaggatggaa
ggcttccagaagagcagggcggaggaagctcgcgacctggtacagattatgttcaaggag
gccaaggctgggaacaccatcaacatgagggagcacttgggaggctacaccatgaacgtg
gtgaccaggatgctgattggaaagaggtactttggaaccgagtccatgggtgagaaggag
gccaccgattttcgggagctcatacacgcggcgattgtcctgcatggagttttctacatt
ccggatcacgtacctctcctcaagtggattgatcccaacggttacaggcgcctgtttaag
aagatggggaagcgaatggacgactactatagctacattgtcgaggagcaccggaagagg
cagcgaaatggtgaagtggtcgacggtcctaaggactttgtggacgttcttctcggcctg
gctggtgagaacagcgagctgcatctcaacgacgtggagatcaaagcactgatacaggat
atggtcgtggggggcaccgataccgcgtccttcactatggagtggtttatgctcgagatg
atccggaacccgaaagtcatgcggaaagtgcaggcggagctagactcggtgctgcaaaag
aaggccaccaacaagcacctgctggaagagtcggacctggcgagcctcgactacctgaga
gcagcggtcaaggaaactttcaggattcacccggttggcggcttcctcatacctcacgag
tcgatccgggacaccaaagttgccggctaccacgtccccaaaggctcgctcatcctcatc
aacactcacggtctgggaagaaacgccgcggtgtgggacaacgtcgacgagttccggccc
gagaggttcctcaggcccgaggacaaagtccacctccgcgactccgagtaccgcgtcatt
ccatttggctccggcaagcgcgcgtgccccggtgcgcagctcgggcagtcgatgctcctc
ctcggcctgggacgacttcttcacggcttcgactggtttccaccgccgggaacgagcagg
gaagacatcgacgttatggaagcttacggcctcacaacgccgccgagaactccgttgcga
gcagtggcgaaagctcgtctggatcagagcttctactctttccattga

  All links  
No link information was found.   
DBGET integrated database retrieval system