KEGG   Selaginella moellendorffii: SELMODRAFT_145135Help
Entry
SELMODRAFT_145135 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
smo  Selaginella moellendorffii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SELMODRAFT_145135
Enzymes [BR:smo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SELMODRAFT_145135
Peptidases [BR:smo01002]
 Cysteine Peptidases
  Family C44
   SELMODRAFT_145135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 581 aa AA seqDB search
MCGILAILGYHEAHLQRSKVLDLSRRLRHRGPDWSGLYHHQNFYLAHERLAIVDPASGDQ
PLYSEDKSIVVAVNGEIYNHEALKASMEHNYNTQSDCEVIAHLYEDFGEDMVQKLDGMFS
FVLLDTRDNSFIAARDPIGITPLYFGWGSDGSVWFASEMKALVDDCERFETFPPGHLYSS
KAGGLRRWYNPPWFSESIPSMPYNPLALREAFEKAVVKRLMTDVPFGVLLSGGLDSSLVA
SVASRHLASTKAGRQWGPQLHTFCVGLKGSPDLKAAKEVADYLGTIHHEFYFTIQEGLDA
LRDVIYHIETYDVTTIRASTPMFLMSRKIKALGVKMVLSGEGSDEIFGGYLYFHKAPNKE
EFHRETCRKIKSLYLYDCLRANKATSAWGVEARVPFLDKEFVDIAMSIDPSEKMIRPGER
IEKWIMRRAFDDEEKPYLPKHILYRQKEQFSDGVGYGWIDSLKAFATKQVSDRMMANAKF
VYPHNTPQTKEAYYYRMLFERVFPQESARLSVPGGPSVACSTAAAVAWDEAWSKNLDPSG
RAATGVHADAYESSEAHPQTSTVEEISKEQLQLCPRVAVAS
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggattctcgcgattctcggctaccatgaggcgcatctccagcgcagcaaggtg
ctggatctctctcgcaggttgaggcaccggggccccgattggagcggcctgtatcatcac
cagaatttctatcttgctcatgagaggctggcgatcgtcgaccccgcttccggggatcag
ccgctctacagtgaggacaagtcgatcgtcgttgcggttaacggcgagatttacaaccac
gaagctctcaaggcgtcaatggaacacaattacaacacgcagagcgattgcgaagtcatt
gcgcatctgtacgaggactttggagaagacatggtccagaagctagatgggatgttctcc
tttgtgctcctcgacacacgagacaatagcttcatagctgctcgtgacccgattggaatc
acgcctttgtactttggctggggttctgatggatctgtatggttcgcgtcagagatgaaa
gctcttgtggatgactgtgaacggtttgaaactttccctcctgggcatttatactctagc
aaagcaggaggcttgcgaaggtggtataatccaccttggttttctgagtcgattccgtcc
atgccttacaatcccttggcacttcgtgaagcattcgaaaaggcagttgtcaagaggctt
atgacagatgttccatttggggtgctactctcggggggccttgactcgtctctagttgcc
tccgtggcttcaaggcacctagctagtacgaaagctgggagacagtggggaccccagctt
cacaccttctgcgtaggcttgaaaggttctccagatctcaaggcggcaaaagaagttgcc
gattaccttggaacaatccatcatgagttttactttacaattcaggaaggtctagatgca
cttcgtgacgtaatctatcacattgagacgtacgacgtgacaacaatcagggccagcacc
ccgatgtttctaatgtcacggaagatcaaagctcttggtgtcaaaatggtgctgtctggg
gaaggatcagacgaaatttttggcggttacctttacttccacaaggctcctaacaaggaa
gaattccaccgggaaacctgcagaaagataaaatcgctctatttgtacgactgtctgaga
gcaaacaaggcgacatctgcatggggtgtggaagcaagggttccatttctagacaaggag
ttcgttgacattgcaatgagtattgatccatctgagaaaatgattcgacctggcgaaagg
atagaaaagtggattatgagacgagcgtttgatgatgaagaaaaaccttatttaccgaag
cacattttgtatcggcagaaggagcagtttagtgacggggtcgggtatggctggatcgat
tctttaaaagcctttgctacaaagcaggtgagcgatcgtatgatggcaaatgctaagttc
gtctatcctcacaacaccccacaaacaaaagaagcatactactatcgcatgctctttgag
agagtttttccacaggaatctgcgagactgagtgttcctggcggcccgagcgtggcatgt
agcacagcggctgcagtagcctgggacgaggcatggtccaaaaacctggatccatcggga
agagctgccactggcgttcacgcggacgcgtacgagtcatcagaggcacaccctcaaacc
agcacggtggaggaaattagcaaggaacagcttcaactctgtcctcgagttgcggtggca
tcgtga

DBGET integrated database retrieval system