KEGG   Selaginella moellendorffii: SELMODRAFT_145705Help
Entry
SELMODRAFT_145705 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K18857  alcohol dehydrogenase class-P [EC:1.1.1.1]
Organism
smo  Selaginella moellendorffii
Pathway
smo00010  Glycolysis / Gluconeogenesis
smo00071  Fatty acid degradation
smo00350  Tyrosine metabolism
smo00592  alpha-Linolenic acid metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELMODRAFT_145705
  Lipid metabolism
   00071 Fatty acid degradation
    SELMODRAFT_145705
   00592 alpha-Linolenic acid metabolism
    SELMODRAFT_145705
  Amino acid metabolism
   00350 Tyrosine metabolism
    SELMODRAFT_145705
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SELMODRAFT_145705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 9650539
NCBI-ProteinID: XP_002968598
JGI: 145705
UniProt: D8RBV6
Position
Unknown
AA seq 389 aa AA seqDB search
MAAEAAIAATAGEVITCNAAVAYEAGAPMIVDKICVAPPKPSEVRLKITHTSLCRTDLTF
WRAIGQKKVFPRIFGHEAAGIVESVGKEVTGVKPGDHVVPLFTGECQECRYCRSGKTNLC
QKFKVDTDRGVLASDGTSRFSTKDGKPIYHFLGTSTFSEYTVVDQACVAKIDKAAPLDKV
CLLSCGMTTGLGASINTAKVEKGSTVAIFGLGTIGFAAAQGAKIAGASRIIGIDVLPEKL
ALGKKFGLTDTVNPKEHDKPIQEVIKEMTDGGVDYAIECVGNVKLIEAAVESVHEGWGKA
VVAGLDDNTKFVSVHPGNFLYGRLLTGTFFGDYKGRSQMNDLVEMYMKKELNLDDFITHN
LPFHKINEAFQLLIEGKCLRCVLHMEHDH
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgaggctgctattgctgctactgccggagaggttatcacttgcaatgctgct
gttgcttatgaggctggagctccgatgatcgtggacaagatttgcgtcgctcctccaaaa
ccaagcgaagttcgtctcaagatcacccacacttcgctgtgccggacggatcttactttc
tggagagccattggccagaagaaggtctttccacgcatttttggccacgaggcggcaggg
attgttgaaagcgttgggaaggaagtgacgggcgtgaaaccaggagatcatgtagtcccg
ctgttcacaggggaatgccaagaatgccggtattgtcggtcagggaaaacaaatctgtgc
cagaagtttaaggtcgacacggacagaggagtgctggcgagcgacggcacttctcgattc
tctaccaaggatggcaagccaatctaccacttcctgggaacttctacgtttagtgagtat
acggtggtggatcaagcatgcgtcgccaagatcgacaaggctgctcctcttgacaaagtt
tgtttgctcagctgtggcatgacaacaggacttggagcttctataaacactgcaaaggtt
gagaagggatcgacagtggcaatctttggtcttggcactatcggatttgctgctgctcaa
ggtgctaagattgccggtgcttcccggatcataggaatcgacgtgcttccggaaaaactc
gcgctaggaaagaaattcgggcttacagacaccgtgaacccgaaggagcatgacaagcct
atccaagaggtgatcaaggaaatgactgatggtggagtcgattacgcgattgagtgtgtc
ggaaacgtcaagctcatcgaagctgctgtggaatctgtccatgagggctgggggaaggca
gtggtggctggcctggacgacaacacaaaatttgtctcagtccatccaggcaattttcta
tatggtcgtttgctcactggaacattctttggcgattacaaagggcggagccaaatgaac
gatctcgtggaaatgtatatgaaaaaggagctcaatcttgacgacttcatcacccacaac
cttcctttccacaaaatcaatgaggcatttcagctgctgatcgaaggaaaatgcctgcga
tgcgttcttcacatggaacacgatcactaa

DBGET integrated database retrieval system