KEGG   Selaginella moellendorffii: SELMODRAFT_145705Help
Entry
SELMODRAFT_145705 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
smo  Selaginella moellendorffii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SELMODRAFT_145705
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELMODRAFT_145705
  Lipid metabolism
   00071 Fatty acid degradation
    SELMODRAFT_145705
  Amino acid metabolism
   00350 Tyrosine metabolism
    SELMODRAFT_145705
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SELMODRAFT_145705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 389 aa AA seqDB search
MAAEAAIAATAGEVITCNAAVAYEAGAPMIVDKICVAPPKPSEVRLKITHTSLCRTDLTF
WRAIGQKKVFPRIFGHEAAGIVESVGKEVTGVKPGDHVVPLFTGECQECRYCRSGKTNLC
QKFKVDTDRGVLASDGTSRFSTKDGKPIYHFLGTSTFSEYTVVDQACVAKIDKAAPLDKV
CLLSCGMTTGLGASINTAKVEKGSTVAIFGLGTIGFAAAQGAKIAGASRIIGIDVLPEKL
ALGKKFGLTDTVNPKEHDKPIQEVIKEMTDGGVDYAIECVGNVKLIEAAVESVHEGWGKA
VVAGLDDNTKFVSVHPGNFLYGRLLTGTFFGDYKGRSQMNDLVEMYMKKELNLDDFITHN
LPFHKINEAFQLLIEGKCLRCVLHMEHDH
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgaggctgctattgctgctactgccggagaggttatcacttgcaatgctgct
gttgcttatgaggctggagctccgatgatcgtggacaagatttgcgtcgctcctccaaaa
ccaagcgaagttcgtctcaagatcacccacacttcgctgtgccggacggatcttactttc
tggagagccattggccagaagaaggtctttccacgcatttttggccacgaggcggcaggg
attgttgaaagcgttgggaaggaagtgacgggcgtgaaaccaggagatcatgtagtcccg
ctgttcacaggggaatgccaagaatgccggtattgtcggtcagggaaaacaaatctgtgc
cagaagtttaaggtcgacacggacagaggagtgctggcgagcgacggcacttctcgattc
tctaccaaggatggcaagccaatctaccacttcctgggaacttctacgtttagtgagtat
acggtggtggatcaagcatgcgtcgccaagatcgacaaggctgctcctcttgacaaagtt
tgtttgctcagctgtggcatgacaacaggacttggagcttctataaacactgcaaaggtt
gagaagggatcgacagtggcaatctttggtcttggcactatcggatttgctgctgctcaa
ggtgctaagattgccggtgcttcccggatcataggaatcgacgtgcttccggaaaaactc
gcgctaggaaagaaattcgggcttacagacaccgtgaacccgaaggagcatgacaagcct
atccaagaggtgatcaaggaaatgactgatggtggagtcgattacgcgattgagtgtgtc
ggaaacgtcaagctcatcgaagctgctgtggaatctgtccatgagggctgggggaaggca
gtggtggctggcctggacgacaacacaaaatttgtctcagtccatccaggcaattttcta
tatggtcgtttgctcactggaacattctttggcgattacaaagggcggagccaaatgaac
gatctcgtggaaatgtatatgaaaaaggagctcaatcttgacgacttcatcacccacaac
cttcctttccacaaaatcaatgaggcatttcagctgctgatcgaaggaaaatgcctgcga
tgcgttcttcacatggaacacgatcactaa

DBGET integrated database retrieval system