KEGG   Selaginella moellendorffii: SELMODRAFT_146890Help
Entry
SELMODRAFT_146890 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SELMODRAFT_146890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 232 aa AA seqDB search
MEVFWTPRAKDNKSLVKLLREEGAVKSDRVASVMGKLDRALFIAEGERNLAYMDCPMQIG
FNATISAPHMHGSCLELLNKHLQPGMHALDVGSGTGYLTAAFALLVGDQGRAAGVEHIPE
LVEQSIKNVRRSPAASLLEPGVLSLHVGDGRLGWPEHAPYNAIHVGAAAPQVPQPLIDQL
KPGGRMVIPVGEGAQELVVIDKGPDGSLKQWTASSVRYVPLTSKDEQLRGGV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggaggttttctggacgccgcgagccaaggacaacaaatcgctcgtcaagctcctccgg
gaggagggcgcggtgaaatccgacagggtcgccagcgtcatggggaagctggatcgcgcc
ttgttcatcgccgagggcgagaggaatctggcgtacatggactgtccaatgcagattgga
ttcaatgccaccatctcggctccacacatgcatggctcgtgcctggagcttctcaacaag
catctccagccgggaatgcacgctctcgacgttggctccggaactggttacttgaccgct
gctttcgctcttctggtgggcgatcaaggtcgcgctgcaggagtggaacacattccggag
ctcgtcgagcagtcgatcaaaaacgttaggcgatccccggcggcttcactgctggagccc
ggcgttctttctctgcacgttggagatggtcgacttggctggcccgagcacgcgccatac
aacgccattcacgttggagccgcggctccgcaagtgcctcagccactgatcgatcagctc
aaaccaggcggccggatggtgataccggttggggagggagcgcaagagctggtggtgatc
gacaaggggcccgatggatcgctcaagcagtggaccgcgtcgagcgtgaggtatgttcct
ctaactagcaaggacgagcagctcaggggaggagtatga

DBGET integrated database retrieval system