KEGG   Selaginella moellendorffii: SELMODRAFT_153855Help
Entry
SELMODRAFT_153855 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
smo  Selaginella moellendorffii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SELMODRAFT_153855
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     SELMODRAFT_153855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 492 aa AA seqDB search
MDKDRVVVAQLLLDGTRVKASFSSSGVLKWDGHGISAGSLIVQKDILGFTDKPITIVLHT
FQFASTGCCGGNQRKRKDVTLEFEQREAYKLWCDAIQECLDRSGRPKRLVVFINPFSGKG
EAEEVYKRDVLPLLAAARIEVTKKVTQFQLHARDMAKSMNIAQYDGVICVSGDGILVEVL
NGLLERPDWARAIKMPIGVVPAGKTFAVLFLLVLCSGNGMAKSLLDAAGEPCNARNATFA
IIRGHTQAVDVATVVQGQTKFYSILLLTWGFVADVDIESEKYRWMGGLRFDFYSLIRILR
LRRYNGVFAYVPAPGYEDIGAPYNGELDGMKVECDDERRGRAATGYSGPVSSSLRSDWRV
MEGAFVMVLLQNVPWASEDFNSAPESKFADGFLDLIVLRDCPRYKLIGLLTSIQQGKAVE
SKYLTYLKVKAFQIAPGGRVGSRIQGGYIDVDGEVVTRGWGAVGDGKGDPMSYGPTIEVC
VEQGLATLYCPP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggatagagtcgtggtagcgcagctcctgctggatggaacgcgcgtcaaggcg
tctttcagctcctcgggggtgctgaaatgggacggccatgggatcagcgccgggagcctc
atcgtccagaaggacattctgggattcacggacaagccgatcacgatcgtgcttcacacc
ttccagtttgcgagcacggggtgctgtggaggcaatcagcgcaagaggaaggacgtgacc
ttggaattcgagcagcgggaggcgtacaagctgtggtgcgatgccatccaagagtgtttg
gatcgatcagggaggccgaagagattggtcgtttttatcaatccctttagtggcaaagga
gaggcagaagaagtctacaagcgcgatgttttgccactactcgcggcagctcggattgag
gtcacgaaaaaagtgactcaattccagcttcatgcgagagacatggccaaatcaatgaat
atcgcgcagtacgatggagttatatgcgttagcggtgatgggattttagtggaggtgtta
aacgggcttttagaaaggccagactgggctcgagcaatcaagatgccgattggagtcgta
cccgcaggcaagactttcgccgtgctttttttgcttgttttgtgttctggaaatggcatg
gctaaatccttgttagatgctgctggcgagccttgcaatgctcgcaatgcaactttcgct
ataatacgcggtcacacacaagcggttgatgtcgccacggttgtacaaggacaaacaaag
ttctacagcattctcctactgacatggggatttgtcgcggacgtggacattgaatccgaa
aagtatcggtggatgggaggtttgcgtttcgacttttacagcttgatacgcatcttacgc
ttgcggcggtacaacggtgttttcgcctacgttccggcgcctggatacgaggacatagga
gcaccttacaatggcgagctcgacggcatgaaagtcgagtgtgacgacgagagaagggga
cgcgccgcgaccggctactcgggaccggtttcctcgtcgctgagaagcgactggagggtg
atggagggagcattcgtgatggttttgctgcaaaacgttccttgggctagtgaggacttt
aactccgcccccgagtccaagtttgcagatggatttctagacctcattgttctccgggac
tgccctcgatacaagctcatcggcctccttacgagcatacagcaagggaaagcggtggaa
tccaagtatctcacgtatctcaaagtgaaagctttccaaatagctcccggtggaagagtg
gggagccggatccaaggaggatacatcgacgtggatggcgaggttgtgacgagaggctgg
ggcgccgtgggcgatggtaaaggagaccccatgtcctatggtccgaccattgaggtctgt
gtggagcaaggtttggccactctttactgtccgccatag

DBGET integrated database retrieval system