KEGG   Selaginella moellendorffii: SELMODRAFT_156451Help
Entry
SELMODRAFT_156451 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
smo  Selaginella moellendorffii
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SELMODRAFT_156451
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    SELMODRAFT_156451
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     SELMODRAFT_156451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 297 aa AA seqDB search
MPDEIVVKEQCHGKARVRVARVWRGDGKDHEFVEWTISIILSSDCIPAYSAGDNSSIVAT
DSIKNTVYALAKLCHQPVSIETFGIKLASHFLDTYKEVTGACVSLVQNNWERVSIDGIPH
QHGFKLGSQKRTAEITISRDKSSVDVVSGFTDLSLLKTTKSGFEGFIRDKFTLLPEVRER
LLASTVTAKWRYARKPSCYTGTYDKVTRTLFETFFGPSKSGVYSPSVQNTLYLMAQEVLR
SVPEVSSIELNMPNLHFLPVNMPTVGVKFDHDVYLPTSEPHGSIQACLARKTLTSKL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgagatcgtagtgaaggagcagtgccacggcaaggcgagagttcgcgttgct
cgcgtgtggcgcggcgatggcaaagatcacgagtttgtggagtggacaatttcgatcatt
ctctcctcggattgcatccctgcgtactccgccggcgacaattccagcatcgtggccact
gattccatcaagaacacagtgtatgctctcgccaagctctgtcaccagccggtgtctata
gaaacttttgggatcaagcttgcctctcacttcctcgatacatacaaagaggtgactgga
gcttgcgtctctctcgtccaaaacaactgggaacgcgtctcaatcgatggaatcccacac
caacacggtttcaagcttggatctcaaaaaagaaccgcggagatcaccatctctcgagac
aaatctagcgtggacgtggtctctggattcacggacctcagcttgctcaaaacaaccaag
tccggctttgaggggtttattcgcgataaattcacgcttcttcctgaagtgagagagcgc
ttgcttgcttcgacggtcaccgcaaaatggagatatgcgagaaagccatcgtgctacact
ggaacctatgacaaagtcacaagaactctctttgaaacattctttgggccatccaagagt
ggagtctacagcccctccgtgcagaacacgctctatcttatggcacaagaggtgttgcga
agtgtcccggaagtcagctcgatcgaattaaacatgccaaatctccattttttgcctgtc
aacatgcccactgttggtgtgaagtttgatcacgacgtctacctcccaacgagtgaacct
cacggatctatccaggcttgcctggctcgtaaaactctaacatcaaagctctag

DBGET integrated database retrieval system