KEGG   Selaginella moellendorffii: SELMODRAFT_157554Help
Entry
SELMODRAFT_157554 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
smo  Selaginella moellendorffii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:smo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SELMODRAFT_157554
Exosome [BR:smo04147]
 Exosomal proteins
  Proteins found in most exosomes
   SELMODRAFT_157554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1700 aa AA seqDB search
MAAASAPITMKEALVLTSLGINPQCITFNHVTMESEKYICVRETTPQNSVVIIDMNLPLQ
PLRRPITADSSLMNPITKILALKAQIPGTSQDHLQIFNIEMKAKMKSHQMSEQVVFWKWI
TSKMLGLVTQQAVYHWSIEGDSEPVKVFDRTANLSGNQIINYRCDPSEKWLVLIGIAPGS
PERPQLVKGNMQLFSVDQQRSQALEAHAASFATFKVSGNEAPSTLISFATKSVTSGTLVS
KLHVIELGAQPGKAAFTKKQADLFFPPDFADDFPVSMQISQKYSLIYVITKLGLLFVYDL
ETATAVYRNRISPDPIFLTSDSPSTGGFYAVNRRGQVLLATVNEATVVPFVSGQLNNLEL
AVNLAKRGNLPGAENLVVQRFQELFQQMKYKEAAELAAESPQGILRTHDTITKFQSVPVQ
PGQTSPLLQYFGTLLTKGKLNAFESLELSRLVVTQNKKNLLENWLADDKLECSEELGDLV
KSVDNDMALKIFIKARVTPKVVAAFAERGEFDKILIYSKQVGYTPDYPFLLQSILRTDPQ
AAVNFALMMAQMEGGCPMDYNVITDLFLQRNLIREATSFLLDVLKPNLPEHAMLQTKVLE
INLVTFPNVADAILANGMFSHYDRPRIGQLCEKAGLYTRALQHYTDLNDIKRVIINTHAI
EPQALVEFFGTLSRDWAMDCMKELLLVNMRGNLQIVVQVAKEYSEQLGIGACVKLFEQFK
SYEGLYFFLGSFLSSSEDPDIHFKYIEAAAKTGQLKEVERVTRESNFYDAEKTKNFLMEA
RLPDARPLINVCDRFGYVPDLTHYLYSNNMLRYIEGYVQKVNPANAHLVVGQLLDDECPE
DFIKNLILSVRSLLPVEPLVEQCEKRNRLRLLTQFLEHLVSEGSQDVHVHNALGKIIIDT
NNNPEHFLTTNPYYDSKVVGKYCEKRDPTLAVVAYRRGQCDTELINVTNKNSLFKLQSRY
VVERMDADLWALVLNPENPYRRQLIDQVVSTALPESKSPDQVSATVKAFMTADLPHELIE
LLEKIVLQNSAFSGNPNLQNLLILTAIKADKSRVMDYVNRLDNFDGPAVGEIAVGAELFE
EAFAIFKKFNLNVHAVNVLLDNIRSIDRAVEFASRVEEDEVWSQVGKAQLKEGLVSDAIE
SFIRADDATQFNDVILAANQARVFEDLVKYLHMVRRKVKEPKVDSELIYAYARIEKLGEI
EEFILQPNVANLQNVGDRLFDETLYEAAKIIFTHISNWGRLASTLVKLHQFQGAVDAARK
ANSAKTWKEVCFACVDAEEFRLAQICGLNVIVQVDDLEEVSDYYQNRGRFDELISLMESG
LGLDRAHMGIFTELGILYAKYRSEKLMEHLKLFSTRINIPRLIRVCNEQKHWKELTYLHI
QYDEYDNAAATIMNHSPDAWDHMQFKDVCVKVANVELYYKAAHFYLQEHPDLLNDLLMVL
APRVDHTRVVDIMRKARNLHLVKPYMVAVQSANVAAVNEALNELYVEEEDYDRLRESIDL
HDNFDQISLAQKLEKHELIELRRVSAYIYKKAGRWRQSVALSKKDNLYKDAMETASQSGD
RDLAEELLSFFIEQQKKECFASCLFTCYDLIRPDVALELAWINNMIDFSFPYLLQFIREY
TSKVDDLIKDKLAADQEVKSKEKEEKDLVAQQNMYAQLLPLALPAPPMPGMGGGPPGFNP
GMPPPFGGMPGYGMPPMGGY
NT seq 5103 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcgagcgctcccatcactatgaaagaggccctggtgctcacgagcttgggc
atcaatccccaatgcatcactttcaaccatgtcacgatggaatccgagaagtacatatgc
gtgagagagaccacgccgcagaacagcgtggttatcatcgacatgaacttgcctctgcag
cctcttcgccgacccattactgccgattcctcgctgatgaatcccatcactaaaattctg
gctctaaaagctcaaattcctggcacgagccaggatcatctccagatttttaacatagaa
atgaaggctaagatgaaatctcatcaaatgtcggaacaggtggttttctggaaatggata
acttcaaagatgcttgggcttgtcacgcagcaagccgtctatcactggtctatagaaggt
gattctgagccggtcaaggtgtttgatagaacggctaacctgtcgggaaatcaaattatt
aactaccgctgtgatccttctgagaagtggctagttctgataggcattgctccaggctct
cccgagcgtccacaactggtgaaaggaaacatgcaactcttttcagtcgatcagcagcga
agtcaagctttggaagctcatgctgcatctttcgctacattcaaggtctccggaaacgaa
gctccttccactctgatatcgttcgcaacgaagtcagttacgtctggcacgctagtatca
aagttgcatgttatcgaacttggtgcccagccagggaaggcagcgtttacaaagaaacaa
gcagacttgttcttccctcccgactttgcagacgacttccccgtctcgatgcagatctca
caaaagtatagccttatctatgttattacgaaactcggtcttctttttgtatatgatctg
gagactgcaacggctgtctataggaatcgtattagtccagatcccattttcctgacatcc
gattccccgtcaactgggggattttatgcagttaatcgtcgagggcaagttctattggct
actgttaacgaggcaactgtcgttcccttcgtcagcggtcagcttaacaatttagagctt
gcggtcaaccttgctaagcgtggcaaccttcctggagccgagaacctggttgtgcaacgg
tttcaggagttattccaacaaatgaagtacaaagaagctgcggagcttgcagctgagtcc
cctcaaggaatccttcgcacgcatgacactattacgaagttccagagtgttcctgtgcaa
cctggacagacgtcacctctgcttcagtattttggtacattgcttacaaaggggaaactc
aacgcttttgagtctctggagctttcacgtctcgttgtcactcaaaacaagaaaaacctt
ttggaaaattggttggctgatgataaactcgagtgcagtgaagaacttggtgatcttgtc
aagtcggttgataatgatatggccttaaaaatcttcatcaaagcaagggttacaccaaaa
gtggtcgcggcatttgcagaacgtggagagttcgataaaattctcatttattctaagcaa
gttggttatactccagattatcccttccttctgcaatctatattgcgaacggatcctcag
gcggccgtaaattttgctctcatgatggctcaaatggaaggcggatgtccaatggactac
aacgttattaccgatctttttctgcagcgaaacctgatacgtgaagcaacatccttttta
ctggatgttttgaagccgaaccttcccgagcatgcgatgttgcagacaaaggttctagag
ataaatctagtgacattcccgaacgtagcggatgcaattttggccaacggaatgtttagt
cactacgataggcctcggattgggcagctttgcgagaaggctggcctatacacgagagca
ttgcagcactatacggacctgaatgacatcaagcgtgtgattatcaacacacacgctatt
gaaccccaggctttagtggaattttttggaaccctctcgcgtgactgggctatggattgt
atgaaggaattgttgctggttaatatgcgaggaaatctgcaaatagttgtgcaggttgcc
aaagaatactcagaacagctaggcattggagcctgtgtgaagctttttgagcagtttaaa
tcatacgaaggtttatacttctttttgggatcctttttgagctcgagcgaggacccggat
attcacttcaaatatattgaagcagcagctaaaacgggccaactgaaagaggtagagcgt
gtcaccagggaatcgaatttctatgatgcagagaagaccaagaactttctgatggaagct
cgtcttcctgacgctcgtcctctcatcaacgtgtgtgatagattcggttacgttcctgat
ttgacacactacttgtattcgaacaacatgcttcggtatattgaaggctacgtccaaaag
gtcaatcctgcaaacgcacatctggtcgtgggccaacttttagatgatgaatgtcctgag
gattttattaaaaatctcatcctctctgttcgatcgttactaccggttgagcctcttgtt
gagcaatgcgagaaacgtaatcggctgagacttctcactcagtttttggagcacctggtt
agcgaaggtagccaagacgtgcatgtgcacaatgcgctcggaaaaattatcatcgatacg
aacaacaatcccgagcacttcttgactacaaatccgtactatgactcgaaagttgtcggg
aagtattgtgagaagcgggatcccaccctggcagtggttgcttaccgtcgtggtcagtgc
gacacagagcttattaatgttacgaataagaattccctgtttaagcttcaatcacgctat
gttgtggaacgaatggatgcggatctttgggctctagtattgaatcccgagaacccctac
agacgccaacttattgaccaagtagtatctaccgccttaccagagagcaagagtcccgat
caagtttcagcaacagttaaagcattcatgactgctgacttgcctcacgagcttattgag
ttgctggaaaagatcgtcctccaaaattcagcattcagtggcaacccgaacttgcaaaat
cttctgatattgactgccatcaaggctgacaagtcgcgggtcatggattacgtcaaccga
ctagacaacttcgatggtcctgccgttggagagattgctgttggtgcggagctgtttgag
gaagcgtttgctatcttcaaaaagttcaacttgaacgtgcatgctgtcaacgtgcttctt
gacaacatccgtagtatcgatcgtgctgtggagtttgcttcgcgagttgaggaggacgag
gtctggagccaagtaggaaaggctcagctgaaggaaggcctggtcagcgatgccatcgag
tcgtttattcgagcagacgatgcaacgcagttcaacgacgtcatactggcagcaaaccag
gctagagtttttgaggatctcgtcaagtacttgcatatggtgcggaggaaagttaaggag
cccaaggtggactctgagctcatttatgcgtacgcacggattgagaagctcggggagatc
gaggagtttattctgcagcctaatgtggccaacctgcaaaatgttggcgaccgtctcttt
gacgagacgctttacgaagctgcgaagattatcttcactcatatctccaactggggtcgt
cttgcaagtactctcgtcaagctccaccaattccaaggtgcagttgacgctgccaggaag
gccaacagtgcgaagacgtggaaagaagtttgcttcgcttgtgttgacgcggaagagttc
aggctcgcacaaatatgtggtctcaacgtcattgtccaggtggatgatttggaggaagtg
agtgactactaccagaataggggacgattcgatgaactgatttctctaatggaaagtggt
cttggactcgaccgcgcacacatgggtatatttacagagctcggaatattatatgccaag
tatcggtccgagaagcttatggaacacttgaagcttttctcaacccgaatcaacattcca
aggctcattcgcgtttgcaacgaacaaaagcactggaaagaactcacgtatctgcacatt
cagtacgacgagtatgacaatgccgctgcaactattatgaaccactctcccgatgcctgg
gatcacatgcagttcaaggatgtctgcgttaaggttgccaacgtggagctgtactacaaa
gctgcccacttctatcttcaagagcatcccgacctcttgaacgatctgttaatggtctta
gctccccgtgtcgatcacactcgtgtggtagacataatgcgcaaggctagaaaccttcat
ctcgtgaagccttacatggtggctgtgcaaagtgcaaatgtggccgctgtgaatgaggct
ctgaacgagctttacgtcgaagaagaagattacgaccgtctcagagaatccatcgatctt
cacgacaattttgatcaaatttctttggcacaaaagcttgaaaagcacgagcttatcgaa
ttgcgccgcgtctctgcctacatttacaagaaagcaggaagatggcgccagtctgttgcg
ctgtccaagaaggacaatctctacaaggacgcgatggaaactgcatcgcaatctggagat
cgtgatcttgccgaagaactgctgtcgttctttattgaacagcaaaagaaggaatgcttc
gcgtcctgcctgtttacatgttacgatttgatccggcccgacgtagcattggagcttgcc
tggataaacaacatgatcgacttctccttcccttacctgttacaattcatccgcgagtac
accagcaaggtggacgatctgatcaaagacaagctagcagccgaccaggaggtcaagagc
aaggagaaggaagagaaggatctagtggctcaacagaacatgtacgctcagctccttcct
ctggctctgcccgctcctccgatgcccggcatgggaggcggtcctccaggattcaacccg
ggaatgccacctccatttggtggaatgcctggctacggcatgcctcccatgggcggatat
tag

DBGET integrated database retrieval system