KEGG   Selaginella moellendorffii: SELMODRAFT_161470Help
Entry
SELMODRAFT_161470 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
smo  Selaginella moellendorffii
Pathway
smo00790  Folate biosynthesis
smo01100  Metabolic pathways
Module
smo_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SELMODRAFT_161470
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SELMODRAFT_161470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PhoD
Motif
Other DBs
NCBI-GeneID: 9635116
NCBI-ProteinID: XP_002991181
JGI: 161470
UniProt: D8T6H3
Position
Unknown
AA seq 476 aa AA seqDB search
MENSRKPMSRMRYNTDLFFLPSWSSLPTVSMGMLASLFYVLLLFLFSRIGGAELPVVSRI
AFGSCAHQDVPQPIWSAVLDFKPEVFIWLGDNIYADNKRPTRVFGKERTAGPWKNIPRFS
PVSLEEMAEKYRKGKSVPEYKRLRATTQIIGTWDDHDYGLNDAGKEFEGKRESQKLMLEN
LDEPLDSPRWSQEGVYTSYSYGPLGKRIKVILLDTRYHRDPIFSDGTVLGEKQWTFLEKE
LTETDAQINIIASSIQVLGNFSSTVRPFFHVEAWSHFPKEQERLFDVIARSNASGVVFIS
GDVHFGEITRYDCGISYPLYDVTSSGLTQAVEQSKLAPLARFSAWLMPTSMRVYNQWCRY
SSCVYGKQNFGTFLIDWTEDNVKIVAEIRDVFGRPALKEIIPLSKLQAQDGAERNFKRLR
KKIQRHCTREVDLPWYLRYRLAAVVYSLFTVIILAVSVSLYCLVRVGSSKLHKKSE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagaattcccggaagccgatgtctagaatgaggtacaataccgatctcttctttcta
ccaagctggtcgtctctgcccactgtgagcatgggaatgctagctagtctcttttatgtt
cttcttctcttcctcttttctcgcattggaggggcggagcttcctgttgtatccaggatt
gcttttggttcgtgtgctcatcaggacgttcctcagccgatatggtcggctgtgctggat
ttcaagcccgaggtgtttatctggcttggagacaacatttacgcggataacaagcggccg
actcgggtgtttggaaaggaacgcaccgctgggccttggaagaacatcccccgcttctct
cctgtgtcgcttgaagaaatggcggagaagtatcggaaagggaagagcgttcccgagtac
aagagattgagagcaactacacagattataggaacttgggatgaccatgattatggcctc
aatgacgctggaaaggagtttgaaggcaagagggagagccaaaagttaatgctggagaat
ttggacgagcctttggacagccccagatggtcccaggagggggtctatacgtcttactct
tatggtcctttaggaaagagaattaaggttattcttctagatacaaggtaccacagagat
ccgattttcagcgacgggacggtgctgggagaaaagcagtggacgtttctggagaaagaa
ctgaccgagaccgatgcgcaaatcaatatcatagcttcgtccattcaagtgttgggcaac
ttttcttcgactgtgcgacctttctttcacgtggaagcatggtcgcactttccaaaagag
caagaacgactttttgatgtaattgcacgctcgaatgcaagtggtgttgtctttatcagt
ggggatgtgcactttggggaaatcactaggtacgactgtggtatcagctacccgctttat
gatgtgacatcgagtggccttacacaggcagtggagcagtctaagcttgctccgctagca
aggttctctgcctggctaatgccaactagtatgagggtatacaatcaatggtgccgatac
agctcttgcgtttatggcaaacagaacttcggaactttcctcatcgactggaccgaggac
aatgtcaaaattgtcgcggagatcagagacgtgtttggacggcctgcgctcaaggagatc
atcccgctctcgaaactccaggcacaagatggagcagagagaaacttcaagcggctaagg
aagaagatccagaggcactgtacacgggaagtcgaccttccctggtacctgagataccga
ctggctgccgtcgtttactctctcttcactgtgatcatactggctgtttctgtttccctt
tactgtctggtgagagtgggaagcagcaagcttcacaagaagtccgagtga

DBGET integrated database retrieval system