KEGG   Selaginella moellendorffii: SELMODRAFT_161472Help
Entry
SELMODRAFT_161472 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
smo  Selaginella moellendorffii
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:smo00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:smo00051]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 478 aa AA seqDB search
MRMGRRSICLASFVALLCLGSTLATQEKRVADQTCGSGFQEGEVEFFPNISKIEYEGPSS
KNPLAFKWYNPEEEIYGKKMKDWLRFSVAFWHTFRGDGSDPFGSPTKQWPWDDGTDSLEM
AFTRMRANFEFLKKLGLNRWCFHDRDIAPEGRTLEESNANLDKVVALAKQLQEGTDIRPL
WGTAQLFKHPRYMHGAATSPDARIYAYAAAQVKKAMEATKELGGENYVFWGGREGYQSLL
NTDLERELNHLGQFLKSAAEYKKKIEFDGVLLIEPKPQEPTKHQYDWDAATAIGFLQKYG
LKDDFKLNIECNHATLAGHSCYHELEVSRINGVLGNIDANTGDAQTGWDTDQFLMDIAET
TQVMLSVLQNGGLAPGGFNFDAKLRRESTDVEDLFISHIAGMDAMARGLRNAAKILEEGT
LPSIVKERYASFDSALGASIESGELGFEELEQEALRMEEPLPASGKQELAEMVFYNSI
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgggaaggaggagcatctgcctggcgtcctttgtggcgcttttgtgcctgggg
tcgacgcttgctacacaggagaagcgagtcgcagatcaaacatgtggttccgggttccag
gaaggggaagtcgagtttttccccaacatctcgaagatagagtacgagggaccctctagc
aagaacccacttgctttcaagtggtacaatccggaggaagagatctatggcaagaagatg
aaggactggctgaggttcagtgtcgccttctggcatacattccgaggggatggtagtgat
ccttttggatctccgacgaagcagtggccttgggatgatggaacggactcgctcgagatg
gccttcacaagaatgcgggcaaactttgagttcctgaaaaagcttggccttaaccgatgg
tgcttccacgatagagatattgcgccagagggccggactctggaggaatcaaatgccaac
ctcgacaaagttgttgctttagctaagcagctacaggaaggcacagacatcaggcctctc
tggggaaccgcgcagcttttcaagcacccaagatacatgcatggcgcggccaccagtccc
gacgctaggatttatgcttatgcagccgctcaagtcaagaaggctatggaggctacgaaa
gagcttggtggggagaattacgtgttctggggtggccgggaaggatatcagtctctcttg
aacacagaccttgagagggagctcaatcacctgggacaatttttgaaatcagccgctgag
tacaagaagaagatcgaatttgacggcgtgcttctcattgaaccaaagcctcaggaaccc
acgaagcatcaatatgattgggatgctgcaactgcgattggattcttgcaaaaatatgga
ttgaaggacgacttcaagctgaacattgaatgcaaccacgcaacgcttgcgggtcacagc
tgctatcatgaactggaagtttctcgaatcaatggagttttgggaaacattgacgccaac
actggtgacgctcaaacaggatgggataccgaccagttcctgatggatattgcagaaacc
acgcaagtgatgctttcagtgcttcagaatggaggtcttgctcctggtggattcaacttc
gatgccaaactgagaagggaaagtacagacgtggaagacttgttcatctctcatatcgct
ggcatggacgcaatggcacgcgggcttcgcaatgcagccaaaatccttgaggagggtact
cttccaagtatcgtgaaagagcgatatgcaagctttgactctgctttgggagcttccatt
gagtctggggagctcggatttgaagagctggagcaggaggccctgagaatggaggagcca
ctacctgcgtctgggaagcaagagctagctgagatggtgttctataactccatataa

DBGET integrated database retrieval system