KEGG   Selaginella moellendorffii: SELMODRAFT_165668Help
Entry
SELMODRAFT_165668 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
smo  Selaginella moellendorffii
Pathway
smo00010  Glycolysis / Gluconeogenesis
smo00620  Pyruvate metabolism
smo00640  Propanoate metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELMODRAFT_165668
   00620 Pyruvate metabolism
    SELMODRAFT_165668
   00640 Propanoate metabolism
    SELMODRAFT_165668
Enzymes [BR:smo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SELMODRAFT_165668
Lipid biosynthesis proteins [BR:smo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SELMODRAFT_165668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 9643272
NCBI-ProteinID: XP_002962663
JGI: 165668
UniProt: D8QVV8
Position
Unknown
AA seq 668 aa AA seqDB search
MEAECVVADDAEELFDASETFKKSALLSSREQYAALYKNSVDDPDGFWSHTASQFFWKSK
WEESKAHTENLDVRKGEIRVEWFKGGCTNICYNAVDRHVEAGRGDDVALLWEANDPGFDM
KLTYKELLDRVCQLSNYLLAVGIKKGDTVAIYMPMLLELPIAMLACARIGAVHSVVFAGF
SAESLAQRILDCKPKVLLTTSGVKRGPKLIKLKEIVDDALNRCVQEGGYSVDYCLTYDNK
LAIKREDTPWKEKRDVWWQDVVPNYPTDCPVEWVDAEDPLFLLYTSGSTGKPKGVLHTTG
GYMVYTATTFKHAFDYHDGDVYWCTADCGWITGHSYVTYGPLLNKATVLIFEGVPNYPDA
GRCWEIVDKYHVTIFYTAPTAIRALMRSGDEPVKRHSRKSLRVLGSVGEPINPSAWRWYF
EVVGDSRCPIADTWWQTETGGFMITPLPGCWPLKPGSATLPFFGVQPAVVDENGKELDGE
CTGFLCMKASWPGIFRSLYGDHARYETTYFAPFKGFYFSGDGCRRDKDGYYWLTGRVDDV
INVSGHRIGTAEVESALVAHPLAAEAAVVGIDHEVKGQGIYAFVTLNEGVEYTADLKSSL
ISTVRCQIGAFAAPDAIHWAPGLPKTRSGKIMRRILRKIASKQLDDLGDISTLADPGVVA
QLIEFTDK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgagtgtgtcgtcgcggatgatgccgaggagctgtttgatgcgtcggaaact
ttcaaaaaatccgctctattgtcgtccagagaacagtacgcagcactgtacaaaaattcc
gtggatgatcccgatggattctggtcgcacaccgcgtcgcagttcttctggaaatccaag
tgggaggagagcaaagctcataccgagaatttggacgttcgcaagggagaaattcgtgtg
gagtggtttaaaggagggtgtaccaacatttgctacaatgctgtggatcggcatgtagag
gcgggcaggggtgacgacgttgctctcttgtgggaagcaaatgatccaggatttgatatg
aagctaacgtacaaagagcttctcgatcgcgtttgtcagctctcaaactatttgctcgct
gtgggaatcaagaaaggcgacactgtagcaatctatatgccaatgctcctcgagttgcct
atagcaatgcttgcctgtgctcgcattggcgctgttcattcggtcgtgttcgctggtttc
tctgctgaatcgcttgcccaacgaattctggattgcaagccaaaggttctgctcacgacc
agtggtgtaaaacggggcccaaagcttatcaaacttaaggaaattgtagatgatgcttta
aatcgatgtgtacaggagggtggctattctgtagattactgtttgacatatgataataaa
ttagcgatcaagagagaagacactccctggaaagagaaaagggatgtgtggtggcaggat
gtcgttccaaattatcccactgattgtccagtggaatgggtagacgcggaggatcctttg
tttttgctgtacaccagtggcagcactgggaaaccaaagggagtgttgcacacaactggt
ggctatatggtctataccgccacaacgttcaagcatgccttcgattaccatgacggagat
gtctactggtgtactgcagattgtggatggatcactggtcacagctacgtcacttatggc
cctttattgaacaaagcgactgtcttgatctttgagggggttccaaattaccccgacgct
ggtcggtgttgggagattgtggacaaataccacgttaccattttctacacggcccccaca
gcgattcgagcattgatgagatcaggagatgagccagtgaaacggcattcgcgaaagtcc
ttgcgcgttttaggaagcgtcggtgaaccgatcaatccaagcgcgtggaggtggtatttc
gaagttgtcggtgatagtcgctgtcccattgcagatacctggtggcaaacagagaccggt
ggcttcatgataacacccttacctggctgttggcctctgaagccgggctcagccacgcta
cctttcttcggtgtacagccagcagtcgtggacgaaaatggcaaggaactcgacggagaa
tgcacgggattcctgtgcatgaaagcctcttggccgggcatatttcgaagtctttacggt
gatcacgcacgatacgaaactacctatttcgctcctttcaaaggattctacttcagcggc
gacggctgtcgcagggataaagatggctactactggttgacaggccgtgtggacgacgtt
atcaacgtgagtggacaccgcattggcactgctgaagtagagtcggctcttgtcgcgcat
cctctggcagccgaggctgccgtggttggcatcgatcacgaggtcaagggtcagggaatc
tatgccttcgtgacactcaacgaaggagtcgagtacacggcagatttaaagtcgagcttg
atatcaactgtgcgatgccagattggagctttcgctgctccagacgcgatccactgggcc
cccggcctgccaaagacgaggagcggcaagatcatgcgaagaattctccgcaagatcgcc
tccaagcagctggatgatctgggagacatcagcaccttggccgatcctggcgtcgtcgct
cagctcatcgaattcacggataaatga

DBGET integrated database retrieval system