KEGG   Selaginella moellendorffii: SELMODRAFT_165987Help
Entry
SELMODRAFT_165987 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smo  Selaginella moellendorffii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SELMODRAFT_165987
   00052 Galactose metabolism
    SELMODRAFT_165987
   00500 Starch and sucrose metabolism
    SELMODRAFT_165987
   00520 Amino sugar and nucleotide sugar metabolism
    SELMODRAFT_165987
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SELMODRAFT_165987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 459 aa AA seqDB search
MELGTLDQISESEKKGFVSLVQRYLSDKGEQIKWEKIQPPTNKDVVPYEDLEPAPSDPAA
TKALLDKLVVLKLNGGLGTTMGCTGPKSVIEVRDGQTFLDLIVQQLEVLNRKYGSNVPLV
LLNSFNTDEDTEQILKKYKDSSLDIITFKQSQYPRIVSEDVMPWPSKGKTDKDGWYPPGH
GDVFPALVNSKVLDKLVAQGKEYVFIANADNLGATVDLKILNHLVKHKNQYCMEVTPKTL
ADVKGGTLISYEGRVQLLEIAQVPEEHVGEFKSIDKFKIFNTNNLWVNLKAINRLVLEGA
LQMEIIPNPKEVSGVKVLQLETAAGAAIRFFDNAIGINVPRSRFLPVKATSDLLLVQSDL
YTVKEGSMIRNPARKSPHNPIIDLGPEFKKVGSFMERFKAIPSIVYLESLKVVGDVWFGR
DITLKGKVVIDAKADKIVIPDSTVLENKLVTPGPSYADI
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggagctggggacattggatcagatcagcgagagcgagaagaagggatttgtgagtctt
gtgcaacgataccttagtgacaaaggcgagcagattaagtgggaaaaaatccagcctcct
accaataaggacgttgttccttatgaagatctcgagcctgcgccttctgatcccgcggcg
accaaggctttgcttgacaagcttgttgttctaaagctcaatggaggtcttggaacgaca
atgggctgtactggtcccaaatctgtcatcgaagtgcgagacggtcagacgttcctcgac
ttgattgtgcagcagctagaggttcttaaccgcaaatatggctcgaacgtgcctttggtg
cttcttaactcgttcaacacagatgaagatacagaacagatattgaaaaagtacaaggat
tcaagcttggatattatcacttttaagcagagccaatacccacgtatcgtttccgaagac
gtgatgccttggccatcaaaaggcaagactgacaaggacggctggtatcctcctgggcac
ggggacgttttcccggctcttgtcaacagtaaggttcttgataaactggtcgcacagggc
aaagaatacgtgtttatagcaaacgccgataatttgggagccacagtcgacctcaaaatt
ttaaaccatctcgttaagcataagaaccagtactgcatggaggttacgccaaaaacattg
gccgatgtgaaaggtggaacactgatatcttatgaaggcagagtacaattactagaaatc
gcgcaagtccctgaagagcatgtgggtgaatttaagtccatcgacaagttcaagatcttc
aacaccaataatctgtgggtgaacttgaaagccatcaatcgattggtcttggaaggggcc
ctgcaaatggaaatcattccgaaccccaaggaagtgagtggcgtcaaggttttacaactt
gagactgcagcaggagctgcaatacgattttttgacaatgccattggtatcaacgttccg
aggtcgaggtttctgcctgtcaaagcaacgtcggatctgttgttggtccagtccgacctg
tacacagtcaaggaaggctccatgattcggaaccctgcgagaaaatccccgcacaatccg
ataattgatcttggtcccgagtttaaaaaggttggaagtttcatggaaaggttcaaggcc
attcccagcatcgtgtatctggagagcttgaaagtggtgggagatgtatggtttggtaga
gatatcacgctaaagggtaaggttgtcatcgatgccaaggccgataaaatcgtgatcccc
gacagcacagtgctggagaacaaactagtcacacccggcccaagttatgcagatatctag

DBGET integrated database retrieval system