KEGG   Selaginella moellendorffii: SELMODRAFT_165987Help
Entry
SELMODRAFT_165987 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smo  Selaginella moellendorffii
Pathway
smo00040  Pentose and glucuronate interconversions
smo00052  Galactose metabolism
smo00500  Starch and sucrose metabolism
smo00520  Amino sugar and nucleotide sugar metabolism
smo01100  Metabolic pathways
Module
smo_M00361  Nucleotide sugar biosynthesis, eukaryotes
smo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SELMODRAFT_165987
   00052 Galactose metabolism
    SELMODRAFT_165987
   00500 Starch and sucrose metabolism
    SELMODRAFT_165987
   00520 Amino sugar and nucleotide sugar metabolism
    SELMODRAFT_165987
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SELMODRAFT_165987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 9655219
NCBI-ProteinID: XP_002963690
JGI: 165987
UniProt: D8QY74
Position
Unknown
AA seq 459 aa AA seqDB search
MELGTLDQISESEKKGFVSLVQRYLSDKGEQIKWEKIQPPTNKDVVPYEDLEPAPSDPAA
TKALLDKLVVLKLNGGLGTTMGCTGPKSVIEVRDGQTFLDLIVQQLEVLNRKYGSNVPLV
LLNSFNTDEDTEQILKKYKDSSLDIITFKQSQYPRIVSEDVMPWPSKGKTDKDGWYPPGH
GDVFPALVNSKVLDKLVAQGKEYVFIANADNLGATVDLKILNHLVKHKNQYCMEVTPKTL
ADVKGGTLISYEGRVQLLEIAQVPEEHVGEFKSIDKFKIFNTNNLWVNLKAINRLVLEGA
LQMEIIPNPKEVSGVKVLQLETAAGAAIRFFDNAIGINVPRSRFLPVKATSDLLLVQSDL
YTVKEGSMIRNPARKSPHNPIIDLGPEFKKVGSFMERFKAIPSIVYLESLKVVGDVWFGR
DITLKGKVVIDAKADKIVIPDSTVLENKLVTPGPSYADI
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggagctggggacattggatcagatcagcgagagcgagaagaagggatttgtgagtctt
gtgcaacgataccttagtgacaaaggcgagcagattaagtgggaaaaaatccagcctcct
accaataaggacgttgttccttatgaagatctcgagcctgcgccttctgatcccgcggcg
accaaggctttgcttgacaagcttgttgttctaaagctcaatggaggtcttggaacgaca
atgggctgtactggtcccaaatctgtcatcgaagtgcgagacggtcagacgttcctcgac
ttgattgtgcagcagctagaggttcttaaccgcaaatatggctcgaacgtgcctttggtg
cttcttaactcgttcaacacagatgaagatacagaacagatattgaaaaagtacaaggat
tcaagcttggatattatcacttttaagcagagccaatacccacgtatcgtttccgaagac
gtgatgccttggccatcaaaaggcaagactgacaaggacggctggtatcctcctgggcac
ggggacgttttcccggctcttgtcaacagtaaggttcttgataaactggtcgcacagggc
aaagaatacgtgtttatagcaaacgccgataatttgggagccacagtcgacctcaaaatt
ttaaaccatctcgttaagcataagaaccagtactgcatggaggttacgccaaaaacattg
gccgatgtgaaaggtggaacactgatatcttatgaaggcagagtacaattactagaaatc
gcgcaagtccctgaagagcatgtgggtgaatttaagtccatcgacaagttcaagatcttc
aacaccaataatctgtgggtgaacttgaaagccatcaatcgattggtcttggaaggggcc
ctgcaaatggaaatcattccgaaccccaaggaagtgagtggcgtcaaggttttacaactt
gagactgcagcaggagctgcaatacgattttttgacaatgccattggtatcaacgttccg
aggtcgaggtttctgcctgtcaaagcaacgtcggatctgttgttggtccagtccgacctg
tacacagtcaaggaaggctccatgattcggaaccctgcgagaaaatccccgcacaatccg
ataattgatcttggtcccgagtttaaaaaggttggaagtttcatggaaaggttcaaggcc
attcccagcatcgtgtatctggagagcttgaaagtggtgggagatgtatggtttggtaga
gatatcacgctaaagggtaaggttgtcatcgatgccaaggccgataaaatcgtgatcccc
gacagcacagtgctggagaacaaactagtcacacccggcccaagttatgcagatatctag

DBGET integrated database retrieval system