KEGG   Selaginella moellendorffii: SELMODRAFT_166455Help
Entry
SELMODRAFT_166455 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 562 aa AA seqDB search
MNSALQCLVHTPQLTTFFLQDYSKEINRDNMMGTKGELAVAFGELLRKVWSPKSSPYSPR
SFKMKLSRFAPQFSGFNQHDSQELLAYLLDGLHEDLNRLKTKPYIEVKDEDGRPDEEVAD
EYWEAHRARNDSVIVDVFQGQYKSTLVCPVCSKVSVTFDPFMYLSLPLPTNTRTMTVTVI
SSDGSSPPKAHAVVVPRQGKCRELAKAVGNSCGLSTDEMLQLFQLKSQHLLEDTLGLSTI
PDTDQLVAYRLPRLSESAQFVAFIQEQLEEKDRFRVPFIIPIPPEGFRTGEDIKCAFEKL
LSQMKTDSEMFDSDMQDRASSDCPFSLWTTDERATKSHLIEFDKPIPSDLYPARINTKYT
YVLVEWSDRVSEFYDLSFLDRLPDVCKAATSKKLRQEAVSLYTCLEAFLKEEPLGPHDMW
YCPRCKQRQQASKKLDLWRLPEILVVHLKRFSYVRYQNKLETFVNFPIHDLDLTKYLAHR
SVPQQHEYELYAVSNHYGGTGGGHYTAFVNLDLDGQWYNFDDSHVTPASEDHLKSPAAYV
LFYRRKKNTDNATSNGQLSPIL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtgcccttcaatgtttagtgcacacgcctcagcttaccacctttttcctccaa
gattacagtaaggaaattaacagggacaacatgatgggaacaaaaggagaactggcagtc
gcatttggagagcttctacgcaaagtatggtcaccaaaatcatccccgtattctccacgt
tcattcaagatgaagctctctcgtttcgctccgcaattcagtggttttaatcagcacgat
tcacaggagttgctggcatatttactggatggactgcacgaagatctaaaccgcttaaaa
acaaagccttacatcgaagtgaaagatgaggatggtcggccagatgaagaggtcgctgac
gaatattgggaagctcacagggctcggaacgattcagtaattgttgatgtgtttcagggc
cagtacaaatcaactttagtctgtccagtttgcagcaaagtgtcagtgacattcgaccct
ttcatgtatttgtctttgcctctccctacgaacactcgtactatgacagttacggtgata
agttccgacggcagctcaccgccaaaggcacacgcagttgtggttccacgacagggcaaa
tgtagggagctagcaaaagccgtaggcaacagttgcggcttgagcaccgacgaaatgctg
cagcttttccagctcaaaagccagcatttactagaggacaccttgggtctgtcgaccata
ccagataccgaccagctggtggcttataggcttccaagattgtcagagagtgcgcagttc
gtggccttcatccaggaacaactggaagaaaaggatcgtttcagagttcctttcatcatt
cccataccaccggagggcttcaggacgggcgaagacatcaagtgtgccttcgagaagcta
ctctctcagatgaaaacggactcggagatgtttgattccgatatgcaagaccgggcgtcg
tcggactgcccgttcagcttgtggacaacggacgaaagagccacaaagtcgcacctgatc
gagttcgacaaaccgatcccctcggacctctatccagcgcggatcaacacaaagtacacg
tacgtgttggtggagtggtccgacagggtctcagagttctacgacttgagcttcctggac
aggctcccagacgtttgcaaggctgcgacttccaagaagttgaggcaggaggcagtgtct
ctctacacttgcctggaagcgtttctaaaggaggaaccactcgggccgcacgacatgtgg
tactgcccgcgctgcaagcaaaggcagcaagcgagcaagaaactagatttgtggcgacta
cccgagatcctggtcgtccacctcaagagattctcctacgtccgctaccagaacaagctg
gaaacgttcgtcaacttcccgattcacgacttggatctgaccaagtacctggcacaccgc
agcgttccacagcagcacgagtacgagctctacgcagtgagcaaccattacggtggaaca
ggaggtggccattacacagcatttgtgaacctggaccttgacggccagtggtacaatttc
gatgacagtcacgtcaccccagcaagcgaagatcatctcaagagtcccgcagcgtacgtt
ttattctatagacgaaagaagaacaccgataatgccaccagtaatgggcaactcagccca
attttgtga

DBGET integrated database retrieval system