KEGG   Selaginella moellendorffii: SELMODRAFT_168809Help
Entry
SELMODRAFT_168809 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
smo  Selaginella moellendorffii
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SELMODRAFT_168809
  Lipid metabolism
   00062 Fatty acid elongation
    SELMODRAFT_168809
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     SELMODRAFT_168809
Lipid biosynthesis proteins [BR:smo01004]
 Fatty acid synthase
  Component type
   SELMODRAFT_168809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 305 aa AA seqDB search
MMKFLLLVASWAMLQLSPAASSVLPFVVLHGISDECKHHGITKFTTDLGTMSGAPGYCIE
IGNGASDSWFLRLDKQVELACKEIKLIPELAGGYNIVGLSQGNLIGRGLIEWCDGPPVNN
MVSLGGPHAGIASLPLCAAYSFCALADIILHMGVYSDFVQNHLAPTGYIKMPKDLSSYYR
SCVFLPKLNNELPQNRNATFKHRLSDLNQLVLVKFDKDTVLVPQETAWFGFFPPNDLTKV
LPMEETALYKEDWIGLKSLHEQGRIQFVTFSGDHLSISDQEMLDHVAPYLKPEKTRQREE
HASIM
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagttcttgctcctggtggcctcttgggcgatgctccaactctctcccgcggcg
tcatcagtcttgccattcgtcgtcttgcatggaatttccgatgagtgcaagcaccacggt
atcaccaagttcactactgatctcggcactatgagtggagctcctggctactgcatcgaa
attggtaacggggccagcgattcgtggtttctgcgccttgacaagcaagttgagctcgcg
tgtaaggagatcaaacttattccagagcttgctggaggctacaacatcgttggtctttcc
cagggaaacttgataggaagaggattgattgaatggtgtgatggacctcctgttaacaat
atggtctctctgggtggtcctcacgctggcatcgcgtctttgcctctttgcgcagcctat
tccttctgcgcattggccgatatcatccttcatatgggtgtctacagcgattttgttcag
aaccatctagcacccactggatatataaaaatgcccaaggatttgtcgtcctattatcgg
agctgtgtattccttccaaagctgaataacgagcttccccagaatcgcaacgcaacattc
aagcaccgtctcagtgacttgaatcagctcgtccttgtcaagtttgacaaggacacagtc
ctggtgccgcaagaaaccgcttggtttggattctttcctcccaacgatctaacgaaagtg
ttaccgatggaagagactgctctatacaaggaagactggattggtctaaagtcactccat
gaacaaggaaggatccaattcgtgacgttctccggagatcatctctccatctcggatcaa
gaaatgttggatcacgtcgcgccttacttgaaaccagagaaaacaagacagagagaagaa
cacgcaagtataatgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system