KEGG   Selaginella moellendorffii: SELMODRAFT_169003Help
Entry
SELMODRAFT_169003 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
smo  Selaginella moellendorffii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:smo01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:smo00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:smo00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 556 aa AA seqDB search
MENGYSSKSLPLDAPAGIRIRGPLSEPSLNRILSREALQFVADLEREFRPRVKFNLGCRR
EEQARYDSGELPGFDPATRELREGDWSCSKTPAVIADRRVEITGPVERKMIINALNSGAK
VFMADFEDSLSPTWDNIVRGQKNLCDAVNRSISFEDKARNKHYKLNDKTAVLFVRPRGWH
LQEAHIEIDGEPATGALIDFGLYYFHNHSSFRSKHDGYGPFFYLPKMQHSREAAVWNAVF
DRAEERMAAPRGSIRATVLIETLPAVFQMHEILYELREHSAGLNCGRWDYIFSFVKTVRA
HPDRLLPDRFQVGMTQHFLKSYTELLIQTCHRRGVHAMGGMAAQIPIRDDPAANDTAFEL
VRADKLREVKAGHDGTWAAHPGLIELVTKVFDDNMPRANQLHIKRDDVRVTEADLLQMPR
GVRTLEGLRHNTRVGIQYLAAWLTGTGSVPLYNLMEDAATAEISRVQNWQWIKYGAVLDG
EIVAVSVSKELFGRVVEEEMGRIEREVGKKRFESGRYREAAALFARQCTKEDLDDFLTLD
AYRHIVKFVPALQARL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggagaatggctactcttccaaatcgcttccgctggacgcgccagcgggcatccggatc
cgcgggcctctctcggagccctccctcaaccggatcctcagccgcgaggcgctccagttc
gtggcggatttggagcgcgagtttcgcccgcgcgtgaaattcaacctgggatgccggcgg
gaggagcaagcgcgctacgatagcggcgagctgccagggttcgatccagccacgcgggag
ctccgcgagggcgattggagctgctccaagacgccggccgtgatcgcggatcgccgggtg
gagatcactggccccgtggagcgcaagatgatcatcaatgccctcaactcgggcgccaaa
gttttcatggccgatttcgaggattccctctctccaacctgggacaacatcgtgcgcggc
cagaagaatctctgcgacgctgtgaatcgatccatctccttcgaggacaaggccaggaac
aagcactacaagctcaatgacaagaccgcggtgctcttcgtccgcccccgcggctggcac
ctccaggaagcccacatcgagatcgatggcgagcccgccactggcgcgctcatcgatttc
ggcctctactacttccacaatcactcctccttccgatccaagcacgacggctatggcccc
ttcttctacctcccaaagatgcagcactcgcgcgaggccgcggtgtggaacgccgtgttt
gatcgagccgaggagaggatggccgcgccgcggggtagcatccgcgcgacggtgctgatc
gagacgctgccggcggtgtttcagatgcacgagatcctgtacgagctgcgcgagcactcg
gccggattgaattgcgggcgctgggactacatctttagcttcgtcaagacggtgcgcgct
caccccgatcgactgctgcccgatcgcttccaggtggggatgacccagcacttcctcaag
agctacacggagctgctcatccagacgtgccatcgccgcggtgtccacgccatgggagga
atggccgcgcagatccccatccgcgacgatcccgccgccaacgacaccgccttcgagctc
gtccgcgcggacaagctccgcgaggtgaaggccgggcacgatggaacctgggcggcgcat
cccggactgatcgagctggtgaccaaggtcttcgacgacaacatgccgcgcgccaaccag
ctccacatcaagcgcgacgacgtgcgcgtcacggaggccgacctcctccaaatgccgcgc
ggcgtgagaaccctagagggcctgcgccacaacacacgtgtcggcatccagtacctcgcc
gcgtggctcacggggactggctccgtaccgctctacaacctcatggaggacgcggcaacg
gcggagattagccgggtccagaactggcagtggatcaagtacggcgccgtgctggatggc
gagatcgtagccgtcagtgtgagcaaggagctgtttgggcgagtcgtggaggaggagatg
gggaggatcgagagagaggtggggaagaagaggtttgagagtgggcgatatcgcgaggcc
gcggcattgtttgcgaggcagtgcaccaaggaggatctggacgacttcctcacgctggat
gcgtatcgacacattgtcaagtttgtgccagcgctccaggcgcgtttgtag

DBGET integrated database retrieval system