KEGG   Selaginella moellendorffii: SELMODRAFT_170545Help
Entry
SELMODRAFT_170545 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
smo  Selaginella moellendorffii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SELMODRAFT_170545
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SELMODRAFT_170545
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SELMODRAFT_170545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 168 aa AA seqDB search
MAQSGSSIYDLTVQDIDGKDVPLSQYKGKVMLIVNVASQCGYTNDAYKEMNELYAKYKDS
GFEILAFPCNQFGNQEPGSNEEIKERACTRFKAEFPIFQKVDVNGSHTAPLFKLLKTEKG
GFLVDAVKWNFTKFLVNRKGEVVEREGPSTSPLKMEKHIKKWLDAPAA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagagtggtagcagcatctacgatctcaccgtgcaggacatcgacggcaaggat
gttcctctcagccagtacaaaggcaaggttatgctcatcgtcaatgtggcgtctcagtgt
ggatacacaaatgacgcttacaaggagatgaatgagctctatgccaagtacaaggatagc
ggcttcgagatcctggcatttccttgcaaccaattcggcaaccaagagcctggctcaaac
gaagagatcaaggaacgagcttgcactcgtttcaaagctgagtttcccatctttcagaaa
gtggatgttaatggaagccacaccgcaccgcttttcaagctgcttaaaactgaaaagggg
ggatttctggttgatgctgtcaagtggaacttcacgaagttcctggtgaatagaaagggc
gaggtcgtggagcgtgagggtccatcaacaagccctctgaaaatggagaagcacatcaag
aaatggctagacgctcctgcagcttga

DBGET integrated database retrieval system