KEGG   Selaginella moellendorffii: SELMODRAFT_170576Help
Entry
SELMODRAFT_170576 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
smo  Selaginella moellendorffii
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:smo03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 268 aa AA seqDB search
MPELPEVEAARRAVELHCKGLICRASVADDTTVIEGMAPFDMQRRLVAKRIVAAHRKGKQ
LWLELDEPPSICFQFGMAGAVYVKGVKSTKYVRSAVKDEDEWPSKYSKVHLVLDTGVEMS
FTDKRRFARVRLIQDPRLSPPISELGPDAYTELPDETTFADSVAKKKTAIKAVLLDQSFI
AGIGNWIADEVLYQSRIHPEQPASTLTAIDCERLRGAIKEVVMTAVDVDADLERFPRDWL
FHHRWGKKPGSVNGEFPKSFNIAHMAGS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcttcccgaggtagaggccgcgcggcgggcggtggagctccactgcaagggc
ctcatttgccgcgccagcgtcgccgacgacacgaccgtgatcgaaggcatggcgccgttt
gatatgcagcgccgccttgtggccaagaggatcgtcgcggcgcatcgcaaaggcaagcag
ctgtggctggagctggacgagcccccaagcatttgcttccagtttggcatggccggagct
gtgtatgtgaaaggagttaagagcacgaagtatgtgaggtctgctgtgaaggatgaagat
gagtggccctccaaatactccaaagttcatctcgtgctggacactggtgtggagatgtcg
ttcacggacaagcgcaggtttgctcgggtccgacttatacaagatccacgcttgtctccg
ccaatatctgagctgggaccggatgcttacacagagcttccggatgaaactactttcgcc
gactctgttgcgaaaaagaagacggctatcaaggctgttctacttgaccagagctttatc
gcggggattggcaactggattgctgatgaagtactctatcagtctagaatacatcctgag
caaccagcgtccaccttaacagctatagattgcgagcgacttcgtggggctatcaaagag
gttgtgatgactgcggttgacgttgatgctgatcttgaacgctttcctagagattggctt
tttcatcaccgctggggtaaaaagcctggcagtgtaaatggtgagtttcctaagagtttt
aatattgcgcatatggcaggttcttga

DBGET integrated database retrieval system