KEGG   Selaginella moellendorffii: SELMODRAFT_170984Help
Entry
SELMODRAFT_170984 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K07199  
5'-AMP-activated protein kinase, regulatory beta subunit
Organism
smo  Selaginella moellendorffii
Pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:smo00001]
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    SELMODRAFT_170984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 270 aa AA seqDB search
MGNANATGGGEPMQSSQPRISEQEGKLGHAGGSSEYLSDSPGESVRCPLMFAPQAPMAPI
SKPDGIGVYEPNLYKEHGGEKGIPCMIVWSLGGNNVSIEGSWDNWSTRQPLQRSGKDFSI
LKLLPAGVYQFKFFVDGEWRHAPDLSCSKDEAGNVSNLIEVQEYVPENLDNVVSFEPPLS
PDSSYTNPFPGPEDFAKEPPAVPPHLHLTLLNVPASSGDAPASMPRPQHVILNHLYVEKG
RSSRSVLALGATHRFRSKYVTVVVYRPLRK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatgcgaatgcgacgggcgggggcgagccgatgcagagctcgcaaccgcggatc
tccgagcaggaagggaagctagggcacgccgggggatcgtcggagtatctctcagacagt
cctggagaatcggtgcgatgcccgctcatgtttgctccacaggcacccatggctcctata
agcaaaccagatggaatcggtgtgtatgagccgaatctctacaaagaacacggtggtgag
aagggaatcccgtgtatgatcgtgtggagcctcggaggaaacaacgtttccatcgagggc
tcatgggacaactggagcaccaggcagccactccagagatctgggaaggatttctccatc
ctaaagttgctcccggcgggagtttaccagtttaagttcttcgtggatggcgagtggagg
cacgctccagatctttcctgctccaaggacgaagctgggaacgtgagcaatctcatcgaa
gtccaggaatacgttccagaaaaccttgacaacgtcgtgagcttcgagccgccattgtct
ccagactcgagctacacgaatccattcccgggcccggaagattttgcaaaggagccaccg
gcagttcctccgcatcttcacctcacactgctcaacgtccccgcctcgtctggagacgcc
ccggcctccatgccgcggccgcagcacgtaatcctcaaccatctctacgtggagaaaggg
aggagctcgcgatcggtgctggcgctgggcgctactcacaggtttagatcaaagtacgtg
acggtggtggtgtacaggcctctccgaaagtga

DBGET integrated database retrieval system