KEGG   Selaginella moellendorffii: SELMODRAFT_170984Help
Entry
SELMODRAFT_170984 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
smo  Selaginella moellendorffii
SSDB OrthologParalogGFIT
Motif
Pfam: AMPK1_CBM AMPKBI
Motif
Other DBs
NCBI-GeneID: 9645349
NCBI-ProteinID: XP_002969965
JGI: 170984
UniProt: D8RFC1
Position
Unknown
AA seq 270 aa AA seqDB search
MGNANATGGGEPMQSSQPRISEQEGKLGHAGGSSEYLSDSPGESVRCPLMFAPQAPMAPI
SKPDGIGVYEPNLYKEHGGEKGIPCMIVWSLGGNNVSIEGSWDNWSTRQPLQRSGKDFSI
LKLLPAGVYQFKFFVDGEWRHAPDLSCSKDEAGNVSNLIEVQEYVPENLDNVVSFEPPLS
PDSSYTNPFPGPEDFAKEPPAVPPHLHLTLLNVPASSGDAPASMPRPQHVILNHLYVEKG
RSSRSVLALGATHRFRSKYVTVVVYRPLRK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatgcgaatgcgacgggcgggggcgagccgatgcagagctcgcaaccgcggatc
tccgagcaggaagggaagctagggcacgccgggggatcgtcggagtatctctcagacagt
cctggagaatcggtgcgatgcccgctcatgtttgctccacaggcacccatggctcctata
agcaaaccagatggaatcggtgtgtatgagccgaatctctacaaagaacacggtggtgag
aagggaatcccgtgtatgatcgtgtggagcctcggaggaaacaacgtttccatcgagggc
tcatgggacaactggagcaccaggcagccactccagagatctgggaaggatttctccatc
ctaaagttgctcccggcgggagtttaccagtttaagttcttcgtggatggcgagtggagg
cacgctccagatctttcctgctccaaggacgaagctgggaacgtgagcaatctcatcgaa
gtccaggaatacgttccagaaaaccttgacaacgtcgtgagcttcgagccgccattgtct
ccagactcgagctacacgaatccattcccgggcccggaagattttgcaaaggagccaccg
gcagttcctccgcatcttcacctcacactgctcaacgtccccgcctcgtctggagacgcc
ccggcctccatgccgcggccgcagcacgtaatcctcaaccatctctacgtggagaaaggg
aggagctcgcgatcggtgctggcgctgggcgctactcacaggtttagatcaaagtacgtg
acggtggtggtgtacaggcctctccgaaagtga

DBGET integrated database retrieval system