KEGG   Selaginella moellendorffii: SELMODRAFT_174313Help
Entry
SELMODRAFT_174313 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smo  Selaginella moellendorffii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:smo00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smo00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smo00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:smo00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 475 aa AA seqDB search
MAAATEAPAKIIDKIWMELGTLDQISESEKKGFVSLVQRYLSDKGEQIKWEKIQPPTNKD
VVPYEDLEPAPSDPAATKALLDKLVVLKLNGGLGTTMGCTGPKSVIEVRDGQTFLDLIVQ
QLEVLNRKYGSNVPLVLLNSFNTDEDTEQILKKYKDSSLDIITFKQSQYPRIVSEDVMPW
PSKGKTDKDGWYPPGHGDVFPALVNSKVLDKLVAQGKEYVFIANADNLGATVDLKILNHL
VKHKNQYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPEEHVGEFKSIDKFKIFNTNN
LWVNLKAINRLVLEGALQMEIIPNPKEVSGVKVLQLETAAGAAIRFFDNAIGINVPRSRF
LPVKATSDLLLVQSDLYTVKEGSVMRNPARKSPHNPIIDLGPEFKKVGSFMERFKAIPSI
VYLESLKVVGDVWFGRDITLKGKVVIDAKADKIVIPDSTVLENKLVTPGPSYADI
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagctacggaagcgccggcgaagatcattgacaagatctggatggagctgggg
acattggatcagatcagcgagagcgagaagaagggatttgtgagtcttgtgcaacgatac
cttagtgacaaaggcgagcagattaagtgggaaaaaatccagcctcctaccaataaggac
gttgttccttatgaagatctcgagcctgcgccttctgatcccgcggcgaccaaggctttg
cttgacaagcttgttgttctaaagctcaatggaggtcttggaacgacaatgggctgtact
ggtcccaaatctgtcatcgaagtgcgagacggtcagacgttcctcgacttgattgtgcag
cagctagaggttcttaaccgcaaatatggctcgaacgtgcctttggtgcttcttaactcg
ttcaacacagatgaagatacagaacagatattgaaaaagtacaaggattcaagcttggat
attatcacttttaagcagagccaatacccacgtatcgtttccgaagacgtgatgccttgg
ccatcaaaaggcaagactgacaaggacggctggtatcctcctgggcacggggacgttttc
ccggctcttgtcaacagtaaggttcttgataaactggtcgcacagggcaaagaatacgtg
tttatagcaaacgctgataatttgggagccacagtcgacctcaaaattttgaaccatctc
gttaagcataagaaccagtactgcatggaggttacgccaaaaacattggccgatgtgaaa
ggtggaacactgatatcttatgaaggcagagtacaattactagaaatcgcgcaagtccct
gaagagcatgtgggtgaatttaagtccatcgacaagttcaagatcttcaacaccaataat
ctgtgggtgaacttgaaagccatcaatcgattggtcttggaaggggccctgcaaatggaa
atcattccgaaccccaaggaagtgagtggcgtcaaggttttacaacttgagactgcagca
ggagctgcaatacgattttttgacaatgccatcggtatcaacgttccgaggtcgaggttt
ctgcctgtcaaagcaacgtcggatctgttgttggtccagtccgacctgtacacagtcaag
gaaggctccgtgatgcggaaccctgcgagaaaatccccgcacaatccgataattgatctt
ggtcccgagtttaaaaaggttggaagtttcatggaaaggttcaaggccattcccagcatc
gtgtatctggagagcttgaaagtggtgggagatgtatggtttggtagagatatcacgcta
aagggcaaggttgtcatcgatgccaaggccgataaaatcgtgatccccgacagcacagtg
ctggagaacaaactagtcacacccggcccaagttatgcagatatctag

DBGET integrated database retrieval system