KEGG   Selaginella moellendorffii: SELMODRAFT_176660Help
Entry
SELMODRAFT_176660 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
smo  Selaginella moellendorffii
Pathway
smo00071  Fatty acid degradation
smo00592  alpha-Linolenic acid metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01212  Fatty acid metabolism
Module
smo_M00087  beta-Oxidation
smo_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SELMODRAFT_176660
   00592 alpha-Linolenic acid metabolism
    SELMODRAFT_176660
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SELMODRAFT_176660
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     SELMODRAFT_176660
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SELMODRAFT_176660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 9657835
NCBI-ProteinID: XP_002978003
JGI: 176660
UniProt: D8S3X4
Position
Unknown
AA seq 721 aa AA seqDB search
MARPGVSLEVGADKVAVITLRNPPVNALAMPVLWGLKEKYEEACSREDVKAIVVTGANGK
FSGGFDISTIQDVQASGNMSALGRISVDLMTKLIEEAGKPSVAAIQGLALGGGLELAMCC
HARVAAPKAQLGLPELQLGIIPGFGGTQRLPRLVGLTKAIEMMLLSKPVTSEEGKELGLV
DELVPAEAVLTTARKVAVDIAEGRRPWCITLHKTDKLEPLGEAREILKFARAQAMKTAPK
LTHPHVCLDAIEEGIVKGGFAGLLKEEKAFQEALFSDASKSLTHIFFAQRSTSKVPGVTD
VGLKPKVVKKVAVIGGGFMGSGIVTALILSNIKVVLKEVNSDFLQQGLNRVKGNLQSRVK
KGKLSKDKFERAISLVEGVLDYEQFGSVDVVIEAVVENVGLKQQIFADLEKFCSPSCVLA
SNTSTIDLNVVGSKTKAQDRIIGAHFFSPAHVMPLLEVVRTEKTSPQVILDLMTLGKTIK
KIPVVVGNCTGFAVNRVFFPYTQAATMLLDLGVDPYRIDRAITGFGMPMGPFRLADFVGF
GVAVAVGQQYLNSFPERVYVSQIFPLMFSDKRLGEGNRKGFYLYDEKRKPRPAPELQGYV
DKSRQLAKLMPGGKPINITDKEIVEMILFPVVNEACRVLEEGVVVKASDLDIATVLGMGF
PPYKGGLVFWADMIGAGYIASKLKEWSETYGKFFQPSPFLQARASQGGKLSDPVKSGKSR
L
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcctggcgtctccctcgaggttggggcggataaggttgctgtgatcacgctc
cggaatcctcccgtcaatgcgctcgcgatgccagtgttgtggggtttgaaggaaaagtac
gaggaagcttgctccagggaggatgtcaaagcaatcgttgtcactggtgcaaatggaaag
ttctctggaggttttgatatctccacgatccaagatgttcaagcgagtggaaatatgtcg
gctttgggacgcatctctgtggatctcatgactaagctcatcgaagaggcggggaaacca
tccgtggcagcgattcaaggactcgctttgggtggtggactggaactcgccatgtgttgt
cacgctagagtggcagctccaaaagcgcagctgggtctaccagagctgcaacttggtatc
attccgggctttggagggacgcaacgccttcctcgtcttgtcggcttgacaaaggctatc
gaaatgatgctgttgtcaaaaccggtaacgtcggaagagggaaaggagttgggactagta
gatgaactcgtccctgctgaggctgtgcttactacagcacgcaaagtggctgttgatatc
gctgaaggacgcaggccatggtgcattacattgcacaaaaccgacaaattagaacctctg
ggcgaagctcgggaaatcttgaaattcgcaagagctcaggcaatgaaaaccgcaccaaaa
ctaacacacccgcacgtctgtcttgatgcgattgaagaaggtattgtaaaaggcggattt
gcggggctgttgaaggaggagaaagcatttcaagaagcattattttcagatgcgtccaag
tccctcacgcatatattttttgctcagaggtcaacctcaaaggtcccaggtgttacagac
gtgggcttaaaacccaaagttgtaaagaaagtggctgtgattggtggaggtttcatgggt
tcaggaattgtcacagcgcttatactaagcaacatcaaagttgttctgaaggaagtgaat
tctgattttttgcagcaaggtctaaatcgtgttaaaggcaacctgcaaagccgtgtgaag
aaaggcaagcttagcaaggataaattcgagagggctatctcactggtagaaggtgttctg
gattatgaacagtttggtagcgttgatgtggtgattgaggctgtggttgagaacgttggt
ttgaaacaacagatttttgcagaccttgaaaagttttgctctccaagttgcgtactggcc
tccaacacatcaaccattgatctgaatgtcgttggctcgaaaactaaggcacaagatcgg
attattggtgcacatttcttcagtcctgcgcatgtgatgccactactggaggtagtgcgg
acggagaaaacatcaccacaagtgatacttgatctgatgacccttggcaagacaataaag
aaaattcccgtagttgtgggcaactgtaccggttttgccgtcaaccgggtctttttcccg
tatacacaggcagcaacgatgctactggacctgggagttgatccgtatcgaattgatcgt
gctataacagggtttgggatgcctatgggacctttcaggctggccgatttcgtcggtttt
ggtgtggctgttgccgtgggacagcaatacttgaattcttttccagaacgtgtttatgtg
tctcagatattccctctgatgttttcggacaagcggctcggcgaaggcaatcgcaagggc
ttttatctatacgacgaaaagcgtaagccacgtccggctccagagctgcaagggtatgtc
gacaagtcgagacaattggcaaagttaatgccgggtggcaagccgatcaacatcactgac
aaggagattgttgagatgatactcttccccgtcgtgaacgaagcctgccgtgtgcttgag
gagggtgtggtggtcaaagcctccgatctggacatcgcaacagtattggggatgggattc
cctccatataagggcgggcttgttttctgggctgacatgattggagctggctacatcgca
tcaaaactgaaggagtggtctgaaacgtatgggaagttcttccagccatcgccattcctc
caagcacgagcatcacagggtgggaaactgagcgatcctgtgaagagtggcaaatcgcga
ttgtaa

DBGET integrated database retrieval system