KEGG   Selaginella moellendorffii: SELMODRAFT_176660Help
Entry
SELMODRAFT_176660 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
smo  Selaginella moellendorffii
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:smo01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:smo00071]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:smo00592]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 721 aa AA seqDB search
MARPGVSLEVGADKVAVITLRNPPVNALAMPVLWGLKEKYEEACSREDVKAIVVTGANGK
FSGGFDISTIQDVQASGNMSALGRISVDLMTKLIEEAGKPSVAAIQGLALGGGLELAMCC
HARVAAPKAQLGLPELQLGIIPGFGGTQRLPRLVGLTKAIEMMLLSKPVTSEEGKELGLV
DELVPAEAVLTTARKVAVDIAEGRRPWCITLHKTDKLEPLGEAREILKFARAQAMKTAPK
LTHPHVCLDAIEEGIVKGGFAGLLKEEKAFQEALFSDASKSLTHIFFAQRSTSKVPGVTD
VGLKPKVVKKVAVIGGGFMGSGIVTALILSNIKVVLKEVNSDFLQQGLNRVKGNLQSRVK
KGKLSKDKFERAISLVEGVLDYEQFGSVDVVIEAVVENVGLKQQIFADLEKFCSPSCVLA
SNTSTIDLNVVGSKTKAQDRIIGAHFFSPAHVMPLLEVVRTEKTSPQVILDLMTLGKTIK
KIPVVVGNCTGFAVNRVFFPYTQAATMLLDLGVDPYRIDRAITGFGMPMGPFRLADFVGF
GVAVAVGQQYLNSFPERVYVSQIFPLMFSDKRLGEGNRKGFYLYDEKRKPRPAPELQGYV
DKSRQLAKLMPGGKPINITDKEIVEMILFPVVNEACRVLEEGVVVKASDLDIATVLGMGF
PPYKGGLVFWADMIGAGYIASKLKEWSETYGKFFQPSPFLQARASQGGKLSDPVKSGKSR
L
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcctggcgtctccctcgaggttggggcggataaggttgctgtgatcacgctc
cggaatcctcccgtcaatgcgctcgcgatgccagtgttgtggggtttgaaggaaaagtac
gaggaagcttgctccagggaggatgtcaaagcaatcgttgtcactggtgcaaatggaaag
ttctctggaggttttgatatctccacgatccaagatgttcaagcgagtggaaatatgtcg
gctttgggacgcatctctgtggatctcatgactaagctcatcgaagaggcggggaaacca
tccgtggcagcgattcaaggactcgctttgggtggtggactggaactcgccatgtgttgt
cacgctagagtggcagctccaaaagcgcagctgggtctaccagagctgcaacttggtatc
attccgggctttggagggacgcaacgccttcctcgtcttgtcggcttgacaaaggctatc
gaaatgatgctgttgtcaaaaccggtaacgtcggaagagggaaaggagttgggactagta
gatgaactcgtccctgctgaggctgtgcttactacagcacgcaaagtggctgttgatatc
gctgaaggacgcaggccatggtgcattacattgcacaaaaccgacaaattagaacctctg
ggcgaagctcgggaaatcttgaaattcgcaagagctcaggcaatgaaaaccgcaccaaaa
ctaacacacccgcacgtctgtcttgatgcgattgaagaaggtattgtaaaaggcggattt
gcggggctgttgaaggaggagaaagcatttcaagaagcattattttcagatgcgtccaag
tccctcacgcatatattttttgctcagaggtcaacctcaaaggtcccaggtgttacagac
gtgggcttaaaacccaaagttgtaaagaaagtggctgtgattggtggaggtttcatgggt
tcaggaattgtcacagcgcttatactaagcaacatcaaagttgttctgaaggaagtgaat
tctgattttttgcagcaaggtctaaatcgtgttaaaggcaacctgcaaagccgtgtgaag
aaaggcaagcttagcaaggataaattcgagagggctatctcactggtagaaggtgttctg
gattatgaacagtttggtagcgttgatgtggtgattgaggctgtggttgagaacgttggt
ttgaaacaacagatttttgcagaccttgaaaagttttgctctccaagttgcgtactggcc
tccaacacatcaaccattgatctgaatgtcgttggctcgaaaactaaggcacaagatcgg
attattggtgcacatttcttcagtcctgcgcatgtgatgccactactggaggtagtgcgg
acggagaaaacatcaccacaagtgatacttgatctgatgacccttggcaagacaataaag
aaaattcccgtagttgtgggcaactgtaccggttttgccgtcaaccgggtctttttcccg
tatacacaggcagcaacgatgctactggacctgggagttgatccgtatcgaattgatcgt
gctataacagggtttgggatgcctatgggacctttcaggctggccgatttcgtcggtttt
ggtgtggctgttgccgtgggacagcaatacttgaattcttttccagaacgtgtttatgtg
tctcagatattccctctgatgttttcggacaagcggctcggcgaaggcaatcgcaagggc
ttttatctatacgacgaaaagcgtaagccacgtccggctccagagctgcaagggtatgtc
gacaagtcgagacaattggcaaagttaatgccgggtggcaagccgatcaacatcactgac
aaggagattgttgagatgatactcttccccgtcgtgaacgaagcctgccgtgtgcttgag
gagggtgtggtggtcaaagcctccgatctggacatcgcaacagtattggggatgggattc
cctccatataagggcgggcttgttttctgggctgacatgattggagctggctacatcgca
tcaaaactgaaggagtggtctgaaacgtatgggaagttcttccagccatcgccattcctc
caagcacgagcatcacagggtgggaaactgagcgatcctgtgaagagtggcaaatcgcga
ttgtaa

DBGET integrated database retrieval system