KEGG   Selaginella moellendorffii: SELMODRAFT_178124Help
Entry
SELMODRAFT_178124 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
smo  Selaginella moellendorffii
Pathway
smo00010  Glycolysis / Gluconeogenesis
smo00030  Pentose phosphate pathway
smo00051  Fructose and mannose metabolism
smo00052  Galactose metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01200  Carbon metabolism
smo01230  Biosynthesis of amino acids
smo03018  RNA degradation
Module
smo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELMODRAFT_178124
   00030 Pentose phosphate pathway
    SELMODRAFT_178124
   00051 Fructose and mannose metabolism
    SELMODRAFT_178124
   00052 Galactose metabolism
    SELMODRAFT_178124
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SELMODRAFT_178124
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SELMODRAFT_178124
Protein phosphatases and associated proteins [BR:smo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SELMODRAFT_178124
Messenger RNA biogenesis [BR:smo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SELMODRAFT_178124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase Hom_end
Motif
Other DBs
NCBI-GeneID: 9647479
NCBI-ProteinID: XP_002980196
JGI: 178124
UniProt: D8SAN3
Position
Unknown
AA seq 472 aa AA seqDB search
MANGGTDVKQGPKILLEKVPHLKSFLPDLRSYPNPLYQNSYFHPVPGFFVTDREAIAQNI
VMDVDKPVDQNQRYFARAGPRERVFFEGEEVKVAIVTCGGLCPGMNTVIRELVNGLWYQY
HVRDIRGIQAGYRGFFSSEHVPLTPKVVDHWHKQGGTRLGTSRGGFDLQKIVNAIQDRGY
NIVFLIGGDGTLRGAVEIFNEINKRSLKVSIACIPKTVDNDVGIIDRSFGLQTAVEVAQE
AISAAHVEAESTPNGVGLVKVMGRYAGHIAVNATLSSRDVDCCLIPEIKFFTQGQGGLFE
FMEQRLMDNGHCVIVMAEGAGQDLLDENLKESTKDESGNVLLRDIGLWLSTEFKKWWKEK
HPDKLFAVKYIDPTYMVRAVPSNATDTLYCTILAHSAIHGAMAGYTGFVAGPVNGNYCYI
PLELVAVTKNPVDVNNPSWAWVRSVNNQPDFVPPGDDRHKAQEKAVQANLTH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggccaatggagggaccgatgtcaagcaaggccccaaaatactcctggagaaggtgcca
cacctcaagagcttcctcccggacttgcgatcctatcccaacccgctctaccagaacagt
tacttccatccagttccggggtttttcgtcacggacagggaggccatcgcccagaacatc
gtcatggacgttgacaagccggtcgatcaaaaccagcgctactttgctcgggcagggcct
cgagagcgcgtcttcttcgaaggcgaggaagtgaaagttgccatcgtgacgtgcggtggc
ttgtgcccggggatgaacacggtcattcgcgagctggtgaacggtctgtggtatcagtat
cacgtacgtgatattagggggattcaggctggctaccggggattcttctcttcggagcac
gtcccgctgacacccaaggttgtggatcactggcacaagcagggaggaaccaggctggga
acttccaggggtggcttcgacttgcagaagattgtgaacgcgatccaggatcgaggctac
aacattgttttcctcattggaggggatggaactcttcgtggtgctgtggaaatcttcaac
gagatcaataagcgctcgctcaaagtctccatagcttgtatcccgaagactgtggacaac
gatgtcggcataattgacagatcatttggtctccagactgctgtggaggtggcacaggaa
gccattagtgcagctcatgtcgaggcggaaagcactccaaacggcgtcgggcttgtcaag
gttatgggacgctacgccggccacatcgccgtgaatgcaacgctgagcagcagggacgtg
gactgttgcctcattccggagatcaagttcttcacgcagggccaaggtggactcttcgaa
ttcatggagcagcggctgatggacaacgggcactgcgtcatcgtcatggcggagggtgcc
gggcaggacttgctggacgagaacttgaaggagtcgaccaaggatgaatccggcaacgtc
ttgctccgggacatcggactctggctcagcaccgagttcaagaagtggtggaaggagaag
cacccggacaaactcttcgccgtcaagtacatcgatccgacttacatggttcgtgccgtc
ccaagcaacgcgaccgacactctctactgcaccattctcgctcactcggcgattcacggg
gccatggctggctacacgggcttcgtcgcaggcccagtgaacgggaactactgctacatc
cctctggagctggttgcggtgaccaagaatccagtggacgtgaacaatccatcgtgggcg
tgggtgcgatcggtgaacaaccagccagactttgttcctccgggcgatgatcgtcacaag
gcgcaagagaaggccgtccaagccaacttaacacattga

DBGET integrated database retrieval system