KEGG   Selaginella moellendorffii: SELMODRAFT_178197Help
Entry
SELMODRAFT_178197 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
smo  Selaginella moellendorffii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:smo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smo00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:smo00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:smo00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 668 aa AA seqDB search
MEAECVVADDAEELFDASETFKKSALLSSREQYAALYKNSVDDPDGFWSHTASQFFWKSK
WEESKAHTENLDVRKGEIRVEWFKGGCTNICYNAVDRHVEAGRGDDVALLWEGNDPGFDM
KLTYKELLDRVCQLSNYLLAVGIKKGDTVAIYMPMLLELPIAMLACARIGAVHSVVFAGF
SAESLAQRILDCKPKVLLTTSGVKRGPKLIKLKEIVDDALNRCVQEGGHSVDYCLTYDNK
LAIKREDTPWKEKRDVWWQDVVPNYPTDCPVEWVDAEDPLFLLYTSGSTGKPKGVLHTTG
GYMVYTATTFKHAFDYHDGDVYWCTADCGWITGHSYVTYGPLLNKATVLIFEGVPNYPDA
GRCWEIVDKYHVTIFYTAPTAIRALMRSGDEPVKRHSRKSLRVLGSVGEPINPSAWRWYF
EVVGDSRCPIADTWWQTETGGFMITPLPGCWPLKPGSATLPFFGVQPAVVDENGKELDGE
CTGFLCMKASWPGIFRSLYGDHARYETTYFAPFKGFYFSGDGCRRDKDGYYWLTGRVDDV
INVSGHRIGTAEVESALVAHPLAAEAAVVGIDHEVKGQGIYAFVTLNEGVEYTADLKSSL
ISTVRCQIGAFAAPDAIHWAPGLPKTRSGKIMRRILRKIASKQLDDLGDISTLADPGVVA
QLIEFTEK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgagtgtgtcgtcgcggatgatgccgaggagctgtttgatgcgtcggaaact
ttcaaaaaatccgctctattgtcgtccagagaacagtacgcagcactgtacaaaaattcc
gtggatgatcccgatggattctggtcgcacaccgcgtcgcagttcttctggaaatccaag
tgggaagagagcaaagctcataccgagaatttggacgttcgcaagggagaaattcgtgtg
gagtggtttaaaggagggtgtaccaacatttgctacaatgctgtggatcggcatgtagag
gcgggcaggggtgacgacgttgctctcctgtgggaaggaaatgatccaggatttgatatg
aagctaacgtacaaagagcttctcgatcgcgtttgtcagctctcaaactatttgctcgct
gtgggaatcaagaaaggagacactgtagcaatctatatgccaatgctcctcgagttgcct
atagcaatgcttgcctgtgctcgcattggcgctgttcattcggtcgtgttcgctggtttc
tctgctgaatcgcttgcccaacgaattctggattgcaagccaaaggttctgctcacgacc
agtggtgtaaaacggggcccaaagcttatcaaacttaaggaaattgtagatgatgcttta
aatcgatgtgtacaggagggtggccattctgtagattactgtttgacatatgataataaa
ttagcgatcaagagagaagacactccctggaaagagaaaagggatgtgtggtggcaggat
gtcgttccaaattatcccactgattgtccagtggaatgggtagacgcggaggatcctttg
tttttgctgtacaccagtggcagcactgggaaaccaaagggagtgctacacacaactggt
ggctatatggtctatactgccacaacgttcaagcatgccttcgattaccatgacggagat
gtctactggtgtactgcagattgcggatggatcactggtcacagctacgtcacttatggc
cctttattgaacaaagcgactgtcttgatctttgagggggttccaaattaccccgacgct
ggtcggtgttgggagattgtggacaaataccacgttaccattttctacacggccccgaca
gcgattcgagcattgatgagatcaggagatgagccagtgaaacggcattcgcgaaagtcc
ttgcgcgttttaggaagcgtcggtgaaccgatcaatccaagcgcgtggaggtggtatttc
gaagttgtcggtgatagtcgctgtcccattgcagacacctggtggcaaacagagaccggt
ggcttcatgataacacccttacctggctgttggcctctgaagccgggctcagccacgcta
cctttcttcggtgtacagccagcagtcgtggacgagaatggcaaggaactcgacggagaa
tgcacgggattcctgtgcatgaaagcctcttggccgggcatatttcgaagtctttacggt
gatcacgcgcgatacgaaactacctatttcgctcctttcaaaggattctacttcagcggc
gacggctgtcgcagggataaagatggctactactggttgacaggccgtgtggacgacgtt
atcaacgtgagtggacaccgcattggcactgctgaagtagagtcggctcttgtcgcgcat
cctctggcagccgaggctgccgtggttggcatcgatcacgaggtcaagggtcagggaatc
tatgccttcgtgacactcaacgaaggagtcgagtacacggcagatttaaagtcgagcttg
atatcaactgtgcgatgccagattggagctttcgctgctccagacgcgatccactgggcc
cccggcctgccaaagacgaggagcggcaagatcatgcgaagaattctccgcaagatcgcc
tccaagcagctggatgatctgggagacatcagcaccttggccgatcctggcgtcgtcgct
cagctcatcgaattcacggaaaaatga

DBGET integrated database retrieval system