KEGG   Selaginella moellendorffii: SELMODRAFT_178197Help
Entry
SELMODRAFT_178197 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
smo  Selaginella moellendorffii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SELMODRAFT_178197
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELMODRAFT_178197
   00620 Pyruvate metabolism
    SELMODRAFT_178197
   00640 Propanoate metabolism
    SELMODRAFT_178197
Enzymes [BR:smo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SELMODRAFT_178197
Lipid biosynthesis proteins [BR:smo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SELMODRAFT_178197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 668 aa AA seqDB search
MEAECVVADDAEELFDASETFKKSALLSSREQYAALYKNSVDDPDGFWSHTASQFFWKSK
WEESKAHTENLDVRKGEIRVEWFKGGCTNICYNAVDRHVEAGRGDDVALLWEGNDPGFDM
KLTYKELLDRVCQLSNYLLAVGIKKGDTVAIYMPMLLELPIAMLACARIGAVHSVVFAGF
SAESLAQRILDCKPKVLLTTSGVKRGPKLIKLKEIVDDALNRCVQEGGHSVDYCLTYDNK
LAIKREDTPWKEKRDVWWQDVVPNYPTDCPVEWVDAEDPLFLLYTSGSTGKPKGVLHTTG
GYMVYTATTFKHAFDYHDGDVYWCTADCGWITGHSYVTYGPLLNKATVLIFEGVPNYPDA
GRCWEIVDKYHVTIFYTAPTAIRALMRSGDEPVKRHSRKSLRVLGSVGEPINPSAWRWYF
EVVGDSRCPIADTWWQTETGGFMITPLPGCWPLKPGSATLPFFGVQPAVVDENGKELDGE
CTGFLCMKASWPGIFRSLYGDHARYETTYFAPFKGFYFSGDGCRRDKDGYYWLTGRVDDV
INVSGHRIGTAEVESALVAHPLAAEAAVVGIDHEVKGQGIYAFVTLNEGVEYTADLKSSL
ISTVRCQIGAFAAPDAIHWAPGLPKTRSGKIMRRILRKIASKQLDDLGDISTLADPGVVA
QLIEFTEK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgagtgtgtcgtcgcggatgatgccgaggagctgtttgatgcgtcggaaact
ttcaaaaaatccgctctattgtcgtccagagaacagtacgcagcactgtacaaaaattcc
gtggatgatcccgatggattctggtcgcacaccgcgtcgcagttcttctggaaatccaag
tgggaagagagcaaagctcataccgagaatttggacgttcgcaagggagaaattcgtgtg
gagtggtttaaaggagggtgtaccaacatttgctacaatgctgtggatcggcatgtagag
gcgggcaggggtgacgacgttgctctcctgtgggaaggaaatgatccaggatttgatatg
aagctaacgtacaaagagcttctcgatcgcgtttgtcagctctcaaactatttgctcgct
gtgggaatcaagaaaggagacactgtagcaatctatatgccaatgctcctcgagttgcct
atagcaatgcttgcctgtgctcgcattggcgctgttcattcggtcgtgttcgctggtttc
tctgctgaatcgcttgcccaacgaattctggattgcaagccaaaggttctgctcacgacc
agtggtgtaaaacggggcccaaagcttatcaaacttaaggaaattgtagatgatgcttta
aatcgatgtgtacaggagggtggccattctgtagattactgtttgacatatgataataaa
ttagcgatcaagagagaagacactccctggaaagagaaaagggatgtgtggtggcaggat
gtcgttccaaattatcccactgattgtccagtggaatgggtagacgcggaggatcctttg
tttttgctgtacaccagtggcagcactgggaaaccaaagggagtgctacacacaactggt
ggctatatggtctatactgccacaacgttcaagcatgccttcgattaccatgacggagat
gtctactggtgtactgcagattgcggatggatcactggtcacagctacgtcacttatggc
cctttattgaacaaagcgactgtcttgatctttgagggggttccaaattaccccgacgct
ggtcggtgttgggagattgtggacaaataccacgttaccattttctacacggccccgaca
gcgattcgagcattgatgagatcaggagatgagccagtgaaacggcattcgcgaaagtcc
ttgcgcgttttaggaagcgtcggtgaaccgatcaatccaagcgcgtggaggtggtatttc
gaagttgtcggtgatagtcgctgtcccattgcagacacctggtggcaaacagagaccggt
ggcttcatgataacacccttacctggctgttggcctctgaagccgggctcagccacgcta
cctttcttcggtgtacagccagcagtcgtggacgagaatggcaaggaactcgacggagaa
tgcacgggattcctgtgcatgaaagcctcttggccgggcatatttcgaagtctttacggt
gatcacgcgcgatacgaaactacctatttcgctcctttcaaaggattctacttcagcggc
gacggctgtcgcagggataaagatggctactactggttgacaggccgtgtggacgacgtt
atcaacgtgagtggacaccgcattggcactgctgaagtagagtcggctcttgtcgcgcat
cctctggcagccgaggctgccgtggttggcatcgatcacgaggtcaagggtcagggaatc
tatgccttcgtgacactcaacgaaggagtcgagtacacggcagatttaaagtcgagcttg
atatcaactgtgcgatgccagattggagctttcgctgctccagacgcgatccactgggcc
cccggcctgccaaagacgaggagcggcaagatcatgcgaagaattctccgcaagatcgcc
tccaagcagctggatgatctgggagacatcagcaccttggccgatcctggcgtcgtcgct
cagctcatcgaattcacggaaaaatga

DBGET integrated database retrieval system