KEGG   Selaginella moellendorffii: SELMODRAFT_180163Help
Entry
SELMODRAFT_180163 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
smo  Selaginella moellendorffii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:smo00900]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 392 aa AA seqDB search
MASPSLHFADPASNLMGSFASFRGPKCRRKSCLRAMASSSSKNLEIVYDPVGRYEELTRE
LQTSGGFARNLTLFSPSKINVFLRITSKRPDGYHDLASLFHVISLGDTLKFSVSPSKKKD
SLTTNVFGIPLDDSNLVIKALNLYRKKTGSDTYFWVHLDKRVPSGAGLGGGSGNAATALW
AANQINGNLASEADLQEWSAEIGSDIPFFFSHGAAFCTGRGEIVRDIPAPLPLDTPLVLI
KPKEACPTAEVYKHFRIADASSEDPEELLRKIIENGVSQDVCINDLVEAPAFQVLPSLKA
LKQRIMAASRGKYKSLFMSGSGSTLVGVGDPEPPEFIYDDEQHSDTFVSGKSYFVTRRDN
EWYQQPLSQPEAVIDKHDINEVYNQLFTGSDK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtccatcgctccatttcgccgatccagcgagcaatttgatgggcagttttgct
tcgtttcgaggacctaaatgcaggagaaaaagctgcttgagagctatggcgtcgtcgagc
tccaaaaacctcgagattgtctatgatccggtcgggaggtatgaagagctcaccagggag
ctgcaaacctcgggtggttttgctcgaaatcttacattgttttcgccatccaagatcaat
gttttcttgagaatcacgagcaagagacctgatggctaccacgatttagcatcactcttt
catgtgattagcctgggagatactttaaagttttcagtttctccttctaaaaagaaagac
tcgcttacaacaaatgtgtttggaatcccactcgacgactcaaacttggtgatcaaagct
ctaaatctttatagaaagaagaccgggagcgacacatacttctgggttcacttggacaaa
agagttccaagcggtgctggccttggaggtggcagtggtaatgccgccactgctctctgg
gccgcaaaccagataaatggaaaccttgctagcgaagcggatctacaagaatggtctgcg
gagatcggctctgatattcctttctttttctcgcatggagcagccttttgcactggccgt
ggagagattgttcgagacattccagctccgttgcctttggacactccactcgtgctcatc
aagcccaaggaagcgtgtcctactgcggaagtctacaagcactttcgaattgccgacgcg
agctctgaggatccggaggagctactgagaaagatcattgagaatggagtctcgcaagac
gtttgcatcaacgaccttgtagaagctccagcatttcaagtgctaccatctctgaaggct
ctcaagcagcggataatggcagccagcaggggcaaatacaagtccttgttcatgtcagga
agtggtagcactctggttggcgtgggagaccccgagccgccagaatttatatacgatgat
gagcaacatagtgatacgtttgtttcaggcaagtcatattttgtgacaaggagagataac
gaatggtaccagcagccactctcgcaacccgaggcagtcatagacaagcatgacatcaat
gaagtttacaatcagctcttcacaggatctgataagtga

DBGET integrated database retrieval system