KEGG   Selaginella moellendorffii: SELMODRAFT_180165Help
Entry
SELMODRAFT_180165 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
smo  Selaginella moellendorffii
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:smo00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:smo04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 601 aa AA seqDB search
MSATEKPEKHKYKLCGCIGRSFRMTSLSAPKDVEDIFVKYAQNGIIGAAQLQQFLVEVQG
EKDATLKQAEEIIAAQHRESHVIHVLHRQGFNLNTFLQYLLNPQLNPPINLSVSVHHDMT
KPMSHYYICTGHNSYLTGNQLSSACSEVPIIKALQKGVRVIELDLWPNEDAEDKVNVLHG
RTLTTPVDFEKCIVAIKEHAFEASEFPLVITLEDHLTPALQAKVAEIITRNLGDLLYLPD
AQTTCIEFPSPASLKKRILISTKPPKEYLAAVEPPKDVIHPKDGAWGEDIPDYNEQVEEG
AEKASPPAAPDADTNDSDDDDSIGKKTAPEYKRIITIRAGKPKGVPMKEAMAAKEDIVKR
FSVSEPQLEKICKNHPLTVINFTSRNFLRVYPYGLRFNSSNYNPFVAWSHGAQMVAFNMQ
GYGRPLWIVHGFFKANGRCGYVKKPDMFLPNESGGPVYDPAKAASVRTRLKIKIFMGLGW
LEKFGKRHFDNFSPPDFYARVGIAGVPADQKMRRTKAIEDDWHPKWDEEFEFKLTFPELA
VLRLEVHEYDMSDKDDFGGQLCLPVSELKTGLRHVTLCDKRGDELSGVKLLLQITRNDSP
V
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccaccgagaagccggagaagcacaaatacaagctatgcggatgcatcggtagg
agcttcaggatgacatccctgtcagccccaaaggatgtcgaggatatttttgtcaagtac
gcgcagaatggcatcattggggctgcacagttgcaacagttcttggtagaagtccagggc
gagaaagacgcgactctcaaacaggccgaggaaattatagctgcccagcatcgtgaaagt
catgtcatccatgtcttgcatcggcaaggcttcaacctcaacacgtttctacaatatctt
ctcaatcctcaactcaatcctccgatcaacctcagcgtaagtgtccaccatgacatgacc
aagccaatgtcacattactacatttgtactggacacaattcttacctgactgggaaccag
ctgagcagtgcttgtagcgaggtgccaattatcaaggcacttcagaaaggagtacgtgtc
attgagttggatctttggccgaatgaagatgcggaggacaaggtcaatgttcttcatggg
cggacacttacgacaccagtggatttcgagaaatgcatagtcgcaattaaagagcacgcg
tttgaagcatcagaattccccttggttataactttggaagatcatttaactcctgcactc
caagccaaagttgcagagataatcacgcgaaacttaggagacctgctttatcttcccgat
gcacagacgacttgcattgaatttccatcgcctgcgtcgctcaaaaagcgcattttaatt
tccaccaaacctcccaaagagtatctggcagcggtagagccaccaaaagatgttattcat
ccgaaggatggggcctggggagaggacatcccagattacaatgaacaagtcgaggaaggt
gctgaaaaggcttctccacccgcggcacccgatgcagatacaaacgattcagacgacgat
gactctataggcaagaaaacggcccccgagtacaaacggatcatcacaatccgtgccgga
aagccaaaaggagtaccaatgaaagaagctatggcggcaaaggaagacatagtgaaacgc
tttagcgtgagcgagcctcaactggaaaaaatttgcaagaaccaccccctcactgtgatc
aactttaccagccggaacttcttacgagtgtatccgtatggccttcgctttaactcttca
aactataatcctttcgtcgcgtggtcgcacggagctcaaatggtggcattcaacatgcag
gggtatggtagacctctgtggatcgtgcatggattctttaaagcaaatggtcgctgtgga
tacgtgaaaaagccagatatgtttcttccaaatgaatcaggaggcccggtttacgatcct
gccaaagcggcaagcgtcagaacgaggctcaagatcaagatcttcatggggcttggctgg
cttgaaaaattcggcaagcgacacttcgacaacttctcccctccggatttctatgcaaga
gttggaatcgctggcgtccctgcagaccagaagatgcgacgaaccaaagcgatcgaagac
gactggcatccaaagtgggacgaagaattcgagttcaagctcacattcccggagctggct
gtgctgcgtctcgaagtccacgagtatgacatgtccgacaaggacgatttcgggggccag
ctttgtctcccggtttcggagctcaagaccggcctgaggcacgtcaccctgtgcgacaag
cggggcgacgagctctctggagtgaagctgctgctacaaatcacacggaacgattctcca
gtgtga

DBGET integrated database retrieval system