KEGG   Selaginella moellendorffii: SELMODRAFT_182220Help
Entry
SELMODRAFT_182220 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
smo  Selaginella moellendorffii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SELMODRAFT_182220
Translation factors [BR:smo03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    SELMODRAFT_182220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 723 aa AA seqDB search
MAEVALPYRYDPQPPSPQQQPPRPGLNIDWSQVNLDEIQLPPGEDFGIKSEDEEEEEEIV
ESESGFGSIIVVDNLPVVEPAKYEKLENVVRKIFGQMGIIRTLFMPKDKATGKTAGFAFI
EYSSPQEAHTAREQADGYKLDKSHVFMVRMFDDIDKYMKVPEQWVAPEIKSYVPGENLLE
WLMDEKGRDQFVIRFGTETEVCWNDARLLKAETAYHRSFWTESFVQWSPLGTYLATIHRQ
GAVIWGGCTNFSRITRFIHQQVRLIDFSPSEKFLVTYSSHEPSNPRETQKVVLNVFDVRS
GKSHREFKGSADEFATGGTGGVAGVSWPVFRWSGGRDDKYFARIGKHCISVYETETMGLL
DKKSLKVDNVIDFSWSPTDSILALFVPEGNGGNQPARVSLVQIPGREELRQKNLFSVSDC
KMYWQSNGDYLAVKVDRYTKTKKSTYTGFELFRIKERDIPIEVLELENKNDKIIAFAWEP
KGHRFAIIHGDGPRPDVTFYSMKSPNNVDRVTKLATLKGKQANALYWSPAGRFIVLAGLK
AYNGQLEFYNVDDLETMATAEHFMATDVDWDPAGRYVATSVTSVHQMENGFIIWSFHGKL
IYKVSRDRFFQFLWRPRPPSLLSSEEEAEIFRNLKQYSKRYDQEDIESSRFHSTQELEQR
RKLIEEWNGWLSSWKQMHEADKPYRQELRDGEPSDDEQEYEDEEVEIEEVIDVEEIKEED
LEA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtcgccctcccataccgctacgatccacagccgccgtcgccgcagcagcag
ccacccaggcctggcttgaacatcgactggtcgcaggtgaatctcgatgagattcagctc
cctccgggcgaggattttggaatcaagagtgaggatgaagaggaggaggaggagattgtg
gagagcgagtctggtttcgggagcataattgtcgtagacaatctcccggtggtggagcct
gccaagtatgagaagctcgaaaacgtggtacgcaagatttttggacaaatgggaatcatt
agaacgctcttcatgccgaaagacaaagcgactggcaaaacggcgggctttgctttcatc
gagtactccagtccccaggaggcccataccgctcgggaacaagccgatgggtataagctc
gacaagtctcacgtctttatggtgaggatgttcgatgacattgacaagtacatgaaagtt
cccgagcagtgggtagctccagagatcaagagctacgtgccaggggagaatcttctcgaa
tggctgatggacgagaaaggacgcgatcaatttgtgatacgatttggcacggagacagag
gtgtgctggaacgatgcccgtctgttgaaggccgagacggcatatcatcgatcgttctgg
acggaaagctttgttcaatggtctccccttggaacgtatctcgcaacaattcatcggcaa
ggtgctgtcatatggggtggatgcactaactttagccggatcactcgattcattcaccaa
caggtgcggctaattgacttctccccatccgaaaagttcctcgtaacgtacagcagccac
gaaccaagcaatccccgcgaaacacaaaaagtagtgcttaacgttttcgacgtacgaagt
ggtaaatcgcaccgagaattcaagggcagcgccgacgagtttgctactggtgggactgga
ggtgttgccggagtgtcttggccagtgttcaggtggtctggcggccgtgatgacaagtat
tttgcgcgtataggaaagcactgtataagtgtttacgagacagagaccatgggtttactg
gacaagaagtcgctgaaagttgacaatgttatagattttagctggtcaccaaccgattca
attctggccctttttgttccagaaggcaacggtggcaatcaacctgcgagggtcagcctg
gttcaaattcctggcagggaagaactgaggcagaagaaccttttcagtgtcagtgactgc
aagatgtactggcaaagcaacggagactatctagcagtcaaagttgaccggtatacaaag
acgaagaagagcacgtataccggttttgagctcttccggatcaaagaacgagacattcct
atcgaggtcttggagcttgagaacaaaaacgacaagattatcgccttcgcatgggaacca
aagggccacagattcgccatcattcatggagatggtcctcgtcccgacgtaacgttctac
tcgatgaaaagcccaaacaacgtggaccgtgtaaccaagcttgccacgctcaaaggaaag
caggcaaatgctctctactggtcgcctgcggggcgcttcattgtgctggcgggtctcaag
gcgtataacgggcagctcgagttctacaatgttgatgatctcgaaactatggcaacggca
gagcatttcatggcaactgatgtggattgggatcccgctggaagatatgtggctacttct
gttacttccgtgcaccaaatggagaacggcttcattatctggtctttccatgggaagctg
atatacaaggtttcaagggacagattcttccagttcttgtggcgccccaggcctccatct
ctccttagtagcgaagaggaagccgagatttttaggaacttgaaacagtattccaagagg
tatgaccaagaggacatagaatcgtcgaggttccacagcacccaggagttggagcagagg
aggaagctgattgaggagtggaacgggtggctgtcttcgtggaagcaaatgcacgaggcg
gacaagccttaccggcaggagcttcgtgatggcgagcccagcgacgacgagcaggagtac
gaagacgaagaggttgagattgaggaggtgattgatgtggaagagatcaaggaagaggac
cttgaggcgtaa

DBGET integrated database retrieval system