KEGG   Selaginella moellendorffii: SELMODRAFT_182308Help
Entry
SELMODRAFT_182308 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 141 aa AA seqDB search
MAKAAEKKPVAEKVPAEKKAAEKKPRAEKKTPAKDPSAAADKKKRKMKKSVETYKMYIYK
VLKQVHPETGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLILP
GELAKHAVSEGTKAVTKFTSS
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcagcggagaagaagcctgtagctgagaaggtcccagcggagaagaaggcg
gcggagaagaagccgcgggcggagaagaagaccccggccaaggatccatcggcggcggcg
gacaagaagaagcgcaagatgaagaagagcgtggagacgtacaagatgtacatatacaag
gtactcaagcaggtccaccccgagacgggcatttcgagcaaggccatggggatcatgaac
agcttcatcaacgacatcttcgagaagctagcgcaggaggcctcgaggttggctcgctac
aacaaaaagcccacaatcacctcgcgggagatccagacggcggttcgtctcatccttccc
ggcgagctcgccaagcatgccgtgtccgaagggaccaaggccgtcaccaagttcacgagc
tcttga

DBGET integrated database retrieval system