KEGG   Selaginella moellendorffii: SELMODRAFT_183371Help
Entry
SELMODRAFT_183371 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
smo  Selaginella moellendorffii
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SELMODRAFT_183371
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SELMODRAFT_183371
   00640 Propanoate metabolism
    SELMODRAFT_183371
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SELMODRAFT_183371
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    SELMODRAFT_183371
Enzymes [BR:smo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SELMODRAFT_183371
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SELMODRAFT_183371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 2192 aa AA seqDB search
MEANGHPHSQVDDYCFSLGGARPIHSILIANNGMAAVKFMRSVRSWAYEAFGAERAVVLV
AMATPEDMRINAEHIRMADQFVEVPGGTNNNNYANVQLITEVAERAGVAAVWPGWGHASE
NPDLPSSLAARNIVFLGPPAAPMAALGDKIGSSLIAQAAGVPTLPWSGSNVAVPFESCRD
GIPEELYKQACVFSAEEALAMCQKIGYPAMIKASWGGGGKGIRKVHNDEEVKALFKQVQG
EVPGSPIFIMKVASQCRHLEVQLLCDQYGNVAALHSRDCSVQRRHQKIIEEGPITIAPPE
TVRLLEQGARRLAQCVSYVGAATVEYLYSMETGEFHFLELNPRLQVEHPVTEWIAEVNLP
AAQLAVGMGIPLWKIPEIRRFYGKEDQLVHNQTNWHAAAADTAVAFDFDTAVANKPRGHV
VAVRVTSEDPDDGFKPTTGKVQEVSFRSKPNIWAYFSVKSGGGIHEFSDSQFGHVFAFGE
TRPAAIANMVLGLKELHIRGEIHTNVDYTVDLLHAPEYKNNKIHTGWLDGRIAMRLRAER
PLWYLSVVCGAIYRTSRLCAARVSEYIGYLEKGQIPPKNISLVNFRTSLNIDGSKYTMEL
TKGGPGTYRLNMNNSRVEAEVHTLRDGGLLVQLDGNSHVVYGEEEAAGTRLLIDGRTCLL
QNDHDPSRLIAETPCKLMRFLVADGSHVDTDTPYAEVEVMKMCMPLLSPASGTIHFKHLE
AQAMVAGDLIAVLDLDDPSAVRKAVPFSEGFPALGTPIPVPGKVHHRCALIINASNMILA
GYEHNVDEVVQTLLSCLDDPQLPVLQWQECIAVLASRIPTNLKARLDLKLKEYEASSGSE
RGAADFPAKGVREVLEEFLASATDQDRATQERLVEPLLTLAKSYEGGRRGHACSIVKALF
EEYLLVEEHFSQGTGTQADVIESLRHVHKKDLWKVVDIVLSHQGIKTKNALMLRLIEALV
YPNPSAYRDQLVRLAALSDSNYTELAVKSSLLLEQSKLSGIRADIARSLSELGMFTEDEN
GSKRSGKSAIDERMEYWVDAPVAVEDALVALFDHGDHGDHTLQRRVIETYIRRLYQPYLV
KGSVRMQWQRSAMLASWQFYEEGPLRVAAAAEESEPVKWRGAMAVLSSLNTLSSTVRTAL
EEWFGVTQETKDSNHTRLGNVLHIALVGRKNQLSAHQDSGDEGQTQERVEKLAKGLKGET
LRGLLQAAGVGVVSCIIQRDEGRGPIRHCFHWSQETKSYAEDPLYRHVEAPLSGFLELDN
LKELGTMKYSLSRDRQWHLYSVQEKKGKSTVKRTFLRTFVRQTKTLDEDGTFESVIKALQ
GALEELEVAEGRAEHVHMYLCVLRPQGVRSLASSIVMWLEALVHKIYAALGTRMYRLAVL
AWELRMSLGGEGIWRVVVSNATGYTCKVEIYREVRDPLTKQTVYSSPFPGCEGPLHGVPL
SKQCKPLEALDSRRLLARKNGTTFCYDFPLVFEAALKQCWKESGMELPKDTTAFCATELV
FPTANQSWDATLVETNRPSASNDIGMVAWRLELCTPEYPQGRHLIVVSNDVTHAAGSFGP
KEDAFFKCVTDMACREKLPLVYLAANSGARIDVAEEVRRSFQVGWLDDSRPEHGFHYLYL
RPDDYSKLGAFVNAHKLEVADGQVRWVIDDIIGQKDGLGVENLSGSGAIASAYSKAYRET
FTLTYVSGKTVGIGAYLARLGMRCIQRLDQPIILTGYSALNKLLGREVYSSQMQLGGPKV
MATNGVTHLTVSDDLEGVSAILNWLSYVPSVKGGGLPSRPSDDPPDRTVAYVPENSCDPR
AAVAGVYNSEGGGGWMGGIFDKGSFTETLEGWARTVVTGRARLGGIPVGIIAVETQTVMQ
VIPADPGQLDSQERVVPQAGQVWFPDSASKTAQAMIDFNNEGLPLFILANWRGFSGGQRD
LFEGVLQAGSTIVEHLRTYQQPVFVYVPRNGELRGGAWVVVDSKINPDQVEMYADSTARA
GVLEAEGVAEIKFRREQILDSMKRLDPVLPRLEDPAAMRARQDSLIPVYKQIALRFIDMH
DTAFRLAAKGIIRRVVDWECSRSFFYNRLARRLAQESVIQRVLAAAGSECSHRDALELLR
QWFLTWSSSSTGDGDGWADDTLVVEWLASNESRIQRELQQLRVQKVSRQMLSDCQNRNDD
LEVLPQVIRNLVDKMDPAARQALKEQIKAALL
NT seq 6579 nt NT seq  +upstreamnt  +downstreamnt
atggaggccaacgggcatccccactcgcaggtggacgactactgcttctcgctgggcggc
gcgcggcccatccacagcatcctcattgccaacaatggcatggccgccgtcaagttcatg
cgcagcgtcagatcctgggcgtacgaggcgtttggcgcggagagggcggtggtgctcgtc
gccatggccacgcccgaggacatgaggatcaacgccgagcacatccgcatggccgaccag
ttcgtcgaggtgcccggcggcaccaacaacaacaactacgccaatgtgcagctcatcacc
gaggtggccgagcgagccggcgtggcggcagtgtggcccggatgggggcatgcttccgag
aatcccgatcttcccagctcgctcgctgcgaggaatatcgtgttcttggggcctcccgcg
gcgcctatggctgctcttggagataagatcggatcctcgctcatcgcgcaggctgctgga
gttccaacgcttccctggagtggatccaacgttgctgtgccgtttgagagctgtagagat
gggatccccgaggagctctacaagcaagcgtgcgttttctcggccgaggaagcgctggcg
atgtgccagaagattggatacccggccatgatcaaggcgtcctggggtggcggtggcaaa
gggatccgcaaggttcacaacgacgaagaggtcaaggctttgtttaagcaagtgcaaggc
gaagtaccgggctcgccgatctttatcatgaaagttgcctctcagtgccgccacttggag
gtccagcttctgtgtgatcagtatggcaatgtcgctgcgttgcacagccgtgactgcagc
gtccaaaggcgccatcaaaagataatcgaagaggggccgataaccatagctccgcccgag
actgtgcgcctcttggagcaaggcgctcgaagactagcacagtgtgtcagctatgttggt
gctgctactgtggagtacctctacagtatggagactggcgagttccattttctcgagctc
aacccgcggctacaggtagagcatccggtgaccgagtggatcgcggaagttaacttacct
gcggcacagctcgcggttggcatggggattcctctttggaagataccggagatcaggcgg
ttttacggcaaggaagaccagctcgtccacaaccagacgaattggcacgcagctgctgct
gataccgctgtggccttcgactttgacacagcagtggctaacaagcccaggggacatgtt
gtagccgtgcgtgtcactagcgaggatccggacgatggtttcaagcccaccactggcaaa
gtgcaggaagtgagctttagaagcaaaccgaatatatgggcctatttctctgtaaagtct
ggtggtggcatccacgagttctccgattcccagtttggacacgtctttgcgtttggagag
acacgtccggccgccattgcaaacatggtacttgggctcaaagagctgcacatccgaggt
gaaatccataccaacgttgactacaccgtcgatcttcttcacgcgcctgagtacaagaac
aacaagatacatacgggctggctggacggccggattgccatgcgtttgcgggccgagcgg
cctttgtggtatctatcggtggtttgtggagccatttacagaacatcaagactttgtgca
gcacgagtgtccgagtacataggctaccttgagaaaggacaaatcccaccgaagaacatt
tctctcgtcaattttcgcacgtcgctcaacatcgatggcagcaaatacacgatggaatta
acaaaaggtggccccgggacgtacagattaaatatgaataattctcgagtcgaggccgag
gtccacacgctgcgagacggaggtctacttgtccagctggatgggaacagccatgttgtc
tatggagaggaggaagccgctggaacgaggctacttattgatggacgtacatgcttgtta
cagaacgatcatgatccgtcacgactgatagcggagaccccgtgcaagctaatgcgcttt
ctagtggcggacggtagccatgttgacaccgacacaccctacgccgaggtggaagttatg
aaaatgtgcatgcctcttctttcaccggcttccggcacaatccacttcaagcatttggaa
gcacaagcgatggtggccggcgatttgattgcggtgctcgacttggatgatccttctgct
gtgagaaaagcagttccattttcggaaggatttccggcacttggaactccaataccggtc
cctggaaaggttcatcatcgctgtgccttgatcattaatgcctcgaacatgatactcgcc
ggttacgaacacaacgtggacgaggttgtgcagactcttctcagttgcttggacgatcct
cagctgcccgttcttcagtggcaagaatgcattgcagtactcgcaagccgaatcccgacc
aacttgaaagctcggctggatctgaagctgaaagagtacgaagcctcgtctggtagcgag
cgaggagctgcagactttcctgccaagggagtgcgggaagttttagaggaattccttgcc
tccgcaaccgatcaagacagggcgacacaagaaaggcttgtggagcccttgttaacgcta
gccaagtcatacgagggggggcgccggggtcacgcctgcagcatcgtaaaagcactcttt
gaggagtatttgctcgtcgaggagcatttcagccaaggcaccggtacacaggctgacgtc
atcgaaagccttcgacacgtccacaagaaagacctctggaaggttgtcgatattgtgctc
tctcaccagggtatcaagactaagaacgccttaatgttacgccttatcgaagctctcgtg
tatcctaacccctccgcatacagagaccaacttgtgcgtttggcggccttgagtgactca
aactacacggagctggcggtaaagtcgagccttcttctggaacaatctaagttgagcgga
attcgagcagatattgcgcgaagtctatcagagctgggaatgtttacggaggacgaaaac
ggctcaaagcgatctggcaagagtgctatcgacgagagaatggaatactgggttgacgca
ccggttgctgtggaagatgctcttgtggcgttgtttgatcacggtgaccatggcgatcac
acgttgcaaaggcgcgttatcgagacttacatccgaaggctgtatcagccatatctagtg
aaaggttcagtccggatgcaatggcagcgctcggcaatgctagcctcgtggcaattctac
gaggaagggcctctccgggtggcagcagcggcagaagaaagtgaaccagtcaaatggcgt
ggggccatggcggtcctctcgtccttgaacacactctcgtctactgttcggactgcgctt
gaagagtggtttggtgtcacgcaggagaccaaggactctaaccatacccgccttggcaac
gtgctccatattgctctcgtcgggaggaagaaccagctgagtgctcatcaagacagtggt
gatgaggggcagacgcaagaaagagtcgagaagctcgccaagggactcaagggtgagacc
ttgcgaggattgctgcaagctgccggagttggagttgtgagctgcatcatccaaagagac
gaaggcaggggtccaatccgccactgctttcactggtctcaggagacgaaatcatatgca
gaagacccgctctaccgtcacgtcgaggcacctctctctggtttccttgagctggacaac
ttgaaggagcttggaacgatgaagtactcactgtcacgggacaggcaatggcatctttac
tctgtccaggagaagaagggaaagtcgacggtgaagcgcacgtttctacggactttcgtg
aggcaaacgaagacgctggacgaggatggcacttttgagagcgtgatcaaggcgctccaa
ggcgctctggaagagctggaagtcgcagaaggaagagctgagcacgtccatatgtacctt
tgcgtgctgaggccgcagggagtgagaagcctggcctcgtcaatcgtgatgtggctcgag
gcgctggtacacaagatctacgctgctcttggaacacgcatgtaccgcctagccgtgctt
gcatgggagctccggatgtctttgggtggcgaaggcatctggagagtggtggtgtctaac
gctactggttacacttgcaaggttgagatctacagggaggtgcgcgatcctctcacgaag
cagaccgtctatagctcgccgtttccaggttgtgaggggccgctccatggagtcccgttg
tccaagcagtgcaagccgttggaagctctcgactctagacggctgctggccaggaagaac
ggcaccaccttttgctacgacttccctctggtgttcgaggctgcgctcaagcagtgctgg
aaggagtccgggatggagctgcccaaggacaccacagcgttctgcgcaaccgagctcgtg
tttcccacggcaaaccagtcgtgggacgccaccctggtggagacgaaccggcccagcgcc
agcaacgacattggaatggtagcgtggcgtctggagctgtgcactccagagtaccctcag
ggccgccaccttatcgtggtttccaacgacgtaacgcatgccgctggctccttcggcccc
aaggaggacgccttcttcaagtgcgtcacggacatggcgtgccgggagaagctccctctc
gtctacctggccgccaactcgggtgcccggatcgacgtagcggaggaagtgaggaggagc
ttccaggtcgggtggctggacgactctcgcccggagcacggcttccactacctctacctc
cggccggacgactactccaagctcggcgccttcgtgaacgctcacaagctggaggtggcg
gacggacaggtgcgctgggtgatcgacgatatcatcgggcagaaggacgggctcggcgtg
gagaacctctcggggagcggtgccatcgccagcgcctactccaaggcatacagggagacc
ttcaccttgacgtacgtctccggcaagacggtcggcatcggtgcctaccttgctcgtctg
ggaatgcggtgcatccagcggttggaccagccgatcatcctcacgggctactcggcgctc
aacaagctcctgggacgagaagtgtacagctcgcaaatgcagctcgggggacccaaggtg
atggcgacgaacggcgtcacgcatctcactgtgagcgacgatctcgaaggagtgtccgcc
atcctcaactggctgagctacgtccccagcgtcaaaggtggcgggcttccgtctcggccc
agcgacgatcccccggacaggacagtggcctacgtcccggagaacagctgcgatcctcgt
gccgcggtggccggagtttacaactccgagggtggcggcggctggatgggcggtatcttc
gacaaaggcagcttcaccgagacgctcgaggggtgggctcggacggtagtgacagggcgt
gctcggctcggggggataccagttgggatcatcgcggtggagacgcagacggtcatgcaa
gtgatccctgcggaccccggacagctcgactcgcaggagagagtggtgccgcaagccgga
caggtctggttcccggactcggcctccaagacggcccaagccatgatcgacttcaacaac
gaggggctcccgctcttcatcctggccaactggagaggcttctcgggtggccaaagggat
ctctttgagggagttttgcaagccggatccaccatcgtggagcacctccgcacgtaccag
caaccggtgttcgtctacgtgcctcggaatggcgagcttcgaggcggggcctgggtggtg
gtggacagtaagatcaatccggaccaagtcgagatgtacgccgacagcacggctagagcc
ggggtgctcgaggccgagggagtagccgagataaagttccggagggagcaaatcctcgac
tccatgaagcgcttggatccagtactgccacgactcgaggatccagcagcgatgagagct
cgccaggacagcctgattccagtgtacaagcagatcgccctccgcttcattgatatgcac
gacacggccttccggctggccgccaaagggatcatccggcgggtggtggactgggagtgc
tcgaggtctttcttctacaacaggttggcgaggaggctggcccaagaatctgtgatacaa
cgtgtgctagcggctgctggaagcgagtgtagtcaccgggacgcgctggagctgttgagg
cagtggttcttgacgtggagcagcagcagcaccggtgatggggatggttgggccgacgat
actctggttgtggagtggctggccagcaacgagtccaggatccaacgggagctccagcag
ctcagagtgcagaaagtttcgaggcagatgctcagtgattgtcaaaatcgaaacgacgat
ctcgaggtgctgccgcaagttatacggaaccttgttgataagatggatcctgctgccagg
caagcactcaaggagcaaattaaagcagcactactgtaa

DBGET integrated database retrieval system