KEGG   Selaginella moellendorffii: SELMODRAFT_183380Help
Entry
SELMODRAFT_183380 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1323 aa AA seqDB search
MDEGGNATTRGIAALLPPACYLCDLRHEAAPAPAPAPATAAVSKWRMKDRMKTGCVALVL
CLNIGIDPPDVIKISPCARMECWIEPSAKAIDVIGQTLQSQYKRWQPKALYNLRLDSTVD
EVKKLCVQCRETAKSERVLFHYNGHGVPKPTASGEIWFFNQSYTQYIPLSVYELDSWLGS
PSIYVFDCSGAGAIIKAFCERPDFTATKNCILLAACGANELLPQNPVFPADLFTACLTTP
IKVALRWFCSRSLLRDSLRLDLVDKIPGRQIDRKTPLGELNWIFTAVTDTIAWNVLPPEL
FQRLFRQDLLVASLFRNFLLAERIMRSANCAPQCYPRLPLTHQHPMWDAWDMAAEFCLAQ
LPALLDDPNAEFKPSSFFAQQLSAFEVWLSSGSERKPPPEQLPIVLQVLLSQSHRFRALV
LLGRFLDMGPWAIDLALSVGIFPYVLKLLQTTATELRQILVFIWTKILALDKSCQVDLVK
DKGHLYFIRFLDSPDYLAEQQAMAAFVLSVIVDGYPRGQLACHEAGVVSILLRHVQAGTE
LETQAEPLFLQWACLCLGKLWDGTSAAQACAFRENAISSLAQLLSEPQPEVRASAVFALG
TLLSSSKNDAAAEEDNEDDRLVIEQDIAKVLLRAVGDGSPLVRAELAIAFAHFATNHHKF
LNSAAAAYLKPPSNPALADFSSSKSPTGSLICPSQVLLVVRSLSLDQKAQPDVSAAGGEK
QDGSNSSSAPSSAPSSGASSPLDGSKLVVNGSNGNGTLKLRRPRAEDNNSLYLRCIATAY
ALARDTSPQVAELGQKVLHIIGVGSLLNSWKGSGKPGHHRNSSVPSIHLGAGGGLTRSTS
WVETNLASLVAPLRSSASPTRPSFLSVSPMGMRRVPSLEFSPSLTARESTRLSSRIPGEA
SSGLTPTVPKVHSMAGFAEAGSILSATNQTSQQDVPASSLYDWSCGHFSRPLLEPTQDED
GDAPALRLAREKKAVDGISKCQHLHVTKLGDPIWDGQSDNCTRAVVLHPFDPLICAADDK
ETIKVWNYEEKDGSEMNSFDNHSFPERGVSKLCFVNELEHSLLLVASSDGSVRVWKDYAI
KGKQRLATSWQALQGPRPGNRAASAVVDWQQATGYLYASAGESSSIVVWDLDRELLACTI
QAPGESGISAMSASQSPSGVLAVGCCDGAVRIYDIRSHSPLVSGMRPHTHRVIGLEFQSA
SSAQTVVSASQTGDVKFLDLRFPSAAAWGFGAHSRGHLTALSVHRHAPVIATGSMNNGIR
VFNLSGQEVSRIRYYNSFLAVKIGAVSCLSFHPYSVHLAAAAADSIVTIYCGESVDTREQ
QPS
NT seq 3972 nt NT seq  +upstreamnt  +downstreamnt
atggacgagggcgggaacgcgacaaccaggggcattgcggcgcttctcccgcccgcttgc
tacctctgcgacctccgccacgaggcggcgccggcgccggcgccggcgccggccaccgcc
gctgtgtccaaatggagaatgaaggatcggatgaaaacgggatgcgtcgcgcttgttctg
tgcctcaacatcggcatcgatccgccggatgttatcaagatcagcccttgtgcgcggatg
gagtgctggattgagccgtcggcaaaggccattgatgtgattgggcagacgctgcagtcg
cagtacaagcgatggcaacccaaggcactgtacaaccttcggctcgactccacggttgac
gaggtgaagaaactgtgcgtgcagtgcagggaaacggccaagtcggaaagggtcttgttc
cattacaatgggcatggcgtgccgaaaccaacggcaagcggggagatatggtttttcaac
cagagctacacgcagtacatccccctctccgtgtatgagctggattcgtggctgggctcc
ccatccatttacgtctttgattgttctggtgccggagcaatcatcaaggccttctgcgag
cgtccagacttcacagcaacgaaaaactgcattttactcgctgcctgtggtgcaaacgag
cttcttcctcagaaccccgtgtttccggcggacttgttcacagcgtgtctgacgacgcct
atcaaagttgctttgagatggttctgctccagatcgttgctgcgggattcactccgcttg
gaccttgttgacaagattcctggccgacagattgaccgaaagactccactcggggaactg
aattggatattcacggccgtcaccgacaccattgcctggaatgtgcttccaccggaactt
ttccagcgcttgttccggcaagaccttttggttgcaagtctatttcgaaactttctcctt
gcggagcggattatgaggtctgcaaactgtgcacctcaatgttatccgcggctgcctctc
actcatcagcatccaatgtgggacgcctgggatatggcagcagagttctgtttggctcag
cttccggctctgctcgatgatccgaatgcggaattcaaaccaagttcattctttgcgcag
cagctttctgctttcgaggtgtggcttagctcgggatcagagaggaagccgcccccggag
cagttaccgattgtgcttcaggttttactgagccagtcgcatcggtttcgggctctggta
ctactggggaggtttctggatatgggaccttgggcaatcgatctggctttatccgtcggt
atcttcccctacgtcctcaagctacttcaaacgacggcaacagaacttcggcagatattg
gtatttatatggacgaagatccttgccctggacaagtcatgccaggtcgatctggtaaag
gacaaaggtcatttgtactttatcaggtttctggacagcccggactatctggcagaacag
caagctatggctgctttcgttctttccgtcattgttgacgggtatcctcgtgggcagctt
gcatgccacgaagcgggcgtggtttcaatccttctacggcatgttcaagcgggcactgaa
ctggaaacgcaggccgagcctctctttctgcaatgggcgtgcttatgcctcggcaagctt
tgggatggtacaagtgcagcccaggcatgtgccttccgcgagaatgccattagtagtttg
gctcaactcttgagtgaaccgcaacccgaggtccgagcgtcggctgtattcgccctgggg
acgttgctctcttcctcaaagaatgatgcggcggcagaggaagataacgaagacgataga
ctcgtgatcgagcaggacatcgcaaaggttcttttgcgagcggtgggtgatgggagtcct
ctggtcagagctgaacttgccatagcttttgcgcacttcgctaccaaccatcataagttt
ctgaattccgcggcggctgcatatttgaagccgccttcgaaccctgcgctggcggacttc
tcttccagcaagagtcctacaggcagcctgatttgtccgtctcaagtgctactggtagtt
cggtcacttagcctggaccagaaagctcaaccggatgtgtcagcagctggcggtgagaag
caagatggtagtaattcgtcgtccgccccctcgtccgccccctcgtccggggcatcgtcg
ccgctggatggatccaagcttgtagtgaacggctccaacggcaatggcactttgaagctc
aggagaccccgcgccgaggacaataacagcttgtacttgcgttgcattgcaactgcctat
gctttggctcgggatacgtcgccacaagtagcggagctgggtcagaaggttttgcacatt
ataggcgttggctccctgctcaactcatggaaaggctcaggcaagccggggcatcaccgc
aattcgtctgttccgagcattcatcttggcgcgggtggcggactgactcgctctacgtcg
tgggttgaaactaatctagcatctctggttgcgcctctaagaagttccgcgagtcctacc
aggccgagctttctaagcgtcagcccaatgggaatgaggagggtgccgtcccttgaattt
tccccatccttaactgcacgtgagtcgacgagactgtcatcacgtattccgggggaagca
agcagcggcctgactcctacagttcccaaggtccactccatggcaggatttgcggaagcc
ggctccatcctttccgctacgaaccaaacttcccagcaagacgtgcctgcctcctccctc
tacgactggagctgcggccacttctcaaggccactgcttgagccaactcaggacgaagac
ggtgacgctcctgcgttgagattagcgcgcgagaagaaagcagtcgacgggatttcaaag
tgccagcatttacatgtaaccaagctaggtgatccgatctgggatggacaatcggacaat
tgtacgagagcagttgtccttcacccatttgacccccttatttgcgccgctgatgacaag
gagactatcaaggtctggaactacgaggagaaggacggaagcgaaatgaactctttcgac
aaccatagcttccctgaacgcggcgtttcaaaactctgtttcgtgaatgagctcgagcac
agtttactgctggtggcctcaagcgatggcagtgtaagggtctggaaggactacgctata
aagggaaagcagcgcctagcgacgtcgtggcaggcacttcaaggccccaggccgggcaac
cgagctgctagtgctgtcgtcgactggcagcaagcaacgggttacctgtacgcatcagct
ggggagtcgtcgtcaattgtggtctgggatctcgaccgagagctgctggcatgcaccata
caagctccaggagagagtggcatttcagccatgtctgcatcacaatctccgtcgggggtt
ctagctgtaggctgttgtgacggagctgttcgcatctacgacatacgatctcacagcccg
ctcgtctctggtatgaggccacacacgcacagggtgataggattggagttccagtccgcg
tcgagcgctcagacggttgtatcagcgtcgcagactggagacgtgaagtttctcgacctc
cggtttccatcggctgcggcatgggggtttggtgctcacagccgtgggcacttgacggcc
ctcagtgttcatcgccatgcaccggtgattgcaaccggctccatgaacaacggcattcgt
gtgttcaacctgagcgggcaagaggtgagcaggattcggtactacaacagcttcttggcg
gtcaagattggggcggtgagctgcctttcgtttcatccatacagtgtccatcttgcagct
gcggcggcagactccatagtgacaatctactgcggggagagcgtcgatactagagagcag
cagcccagttga

DBGET integrated database retrieval system