KEGG   Selaginella moellendorffii: SELMODRAFT_184724Help
Entry
SELMODRAFT_184724 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 466 aa AA seqDB search
MPSVTVSVKWQKELFPSVEIDTEQPPYVFKCQLFDLTGVPPDRQKIMVKGGLLKDDGDWS
KLAVKEGQRLMMMGTAEEAPKAPEKSTLFVEDLPENEQGVIEQGFTAGLMNLGNTCYMNS
TIQCLHSVPELRSALKSYSAGAGTDMDPSSHTLTLAARDLFGELDSSHRAVAPLRFWTLL
RSKFPQFAQQANNGAYMQQDAEECWTQLVYTLSQRLRPSSGETREATLKNLFGVDISSRI
KCAETEEETEEAETVYSLKCHISQDVNHLNEGLKQGLKSELEKTSPSLGRSAVHSKESVI
TRLPQYLTVQFVRFFWKRETKQKAKILRKVDYPLVLDVMGFCSEELKNELKAPRELLREQ
EDREAGLKGKRKIEDGPAPSSMDWSTTEQGSPTGIYDLVAVLTHKGRSADSGHYVAWVKQ
ENGKWIEFDDDRPIPQREEDITKLSGGGDWHTAYICLYKSRVPKKE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcagttaccgtcagtgtcaagtggcagaaggagctgttcccctctgtggagatc
gacacggagcaaccgccctacgttttcaaatgccagctcttcgatctcaccggagttcct
ccagacaggcagaagatcatggtcaagggcggcctgctcaaggacgatggagattggagc
aagcttgctgtgaaggagggacagcgattgatgatgatgggaactgccgaagaagctccc
aaagctccggaaaagagcacactgtttgtggaagatttgcccgagaacgagcaaggagtg
atcgaacagggattcacagcaggattgatgaacctgggcaatacgtgctacatgaactca
accattcagtgcctccattccgttccggagctaagatccgctctgaaaagctactccgcg
ggagcggggactgacatggacccgtcatcacacactctaacgcttgcggcgcgtgacctc
tttggcgagcttgacagcagccacagggccgtggctcctctccgcttctggacgctgttg
cgaagcaagtttccacagttcgctcaacaagccaacaatggagcttacatgcagcaggat
gcggaagaatgctggacgcaactcgtgtatacactttctcagcgtttgcggccatcttct
ggagagaccagggaggcgacactaaagaatctgtttggtgtagacatctcaagcagaatc
aagtgcgctgaaactgaagaggagaccgaagaagctgaaactgtctactctttaaagtgc
cacatttcacaggacgtcaatcatcttaacgaaggcttgaaacaggggctaaaatccgag
ctcgagaaaacgtcgccttctttgggtagatctgcagttcacagcaaggaatccgttatc
acgcgtcttcctcagtacttgactgtgcagtttgttcgtttcttctggaaacgggaaacg
aaacagaaagcaaagatcttgaggaaagtcgattatccattagttttggatgtcatgggt
ttttgctcggaggaattaaaaaatgaactgaaggcaccacgcgagcttttgagagaacaa
gaggacagagaagctggacttaaaggtaagagaaagattgaagatggaccagcgccttcg
tctatggattggtctaccactgagcaagggagtccaacaggcatatacgacttggtggct
gttttgacgcacaagggacggagtgccgactcggggcactatgtggcttgggtcaaacaa
gaaaatgggaaatggatcgagtttgacgacgatcgcccaattccacaacgggaggaagac
attacaaaactctctggaggaggggactggcacacagcctacatttgtttgtacaagtcg
agagtccccaagaaagagtga

DBGET integrated database retrieval system