KEGG   Selaginella moellendorffii: SELMODRAFT_185064Help
Entry
SELMODRAFT_185064 CDS       T01496                                 

Gene name
DWF5-1
Definition
(RefSeq) hypothetical protein
  KO
K00213  7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
smo  Selaginella moellendorffii
Pathway
smo00100  Steroid biosynthesis
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    SELMODRAFT_185064 (DWF5-1)
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     SELMODRAFT_185064 (DWF5-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG4_ERG24 DUF3021 DUF1661
Motif
Other DBs
NCBI-GeneID: 9647629
NCBI-ProteinID: XP_002990156
JGI: 185064
UniProt: D8T3K9
Position
Unknown
AA seq 461 aa AA seqDB search
MASSIGGKDARKIKGGGAGGAKASSFGTVAGHSASVTYVSMLGLLLFCPPFVIVLWYTLV
HGHGAVSSFWDLAQAKGFQALVEIWPRPTLTACKIIAAFGLFEAFLLLALPGKKFIGPVS
PSGNRPVYKANGMAAYVTTLLVYTAMWRFGWFNPALVYDHLGEIFSTLIFGSIVFCVLLY
IKARQGHVAPSSSDSGSTGNFIADFYWGMELYPRIGSSFDIKTFTNCRFGMMSWAVLAIT
YCIKQHELYGKVSDSMLVSTCLMLVYITKFFWWESGYWCTMDIAHDRAGFYICWGCLVWV
PSVYTSPALYLVRHPNELGTQLALAILVAGLACIYINYDCDRQRQHFRSTNGKCTIWGKA
PGKIEATYVTEKGETKKSLLLTSGWWGLARHFHYVPEISAAFFWSVPALFEHFLPYFYVV
FLTILLLDRAVRDDQRCRTKYKKFWDLYCREVPYKVLPGVY
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcatcgatcggaggaaaggatgccaggaagatcaagggcggcggcgctggcggc
gccaaggcctcatcgtttggcacagtcgcggggcattcggcgtccgtaacttacgtctcg
atgctcggattgcttctcttctgcccgccttttgtgatcgttctatggtacacgctggtg
cacgggcatggcgctgtgtcgagcttctgggatctcgcgcaggccaagggatttcaggcg
ctcgtggagatctggccgaggccgacgctcacagcatgcaagatcatcgcagcgtttgga
ttgtttgaagcgtttttgctgctggcattgcctggcaagaagtttatagggcccgtgtct
ccatctggaaatcgtccagtctacaaggccaatggcatggcggcgtatgtgacgactttg
ctggtatacacggcaatgtggagatttggatggttcaatccagctcttgtctacgatcac
ctcggagagatcttttctactctcatttttggcagcatagttttttgtgttcttctctat
atcaaggcaaggcaaggtcacgttgcaccttcgtcgtctgactctggatcaaccggaaac
ttcatagcagacttttactggggtatggaactgtatccccgaatcggaagctcgtttgac
atcaagacgttcacaaactgtcgctttgggatgatgtcgtgggctgttttggccatcacg
tactgcatcaagcagcatgagttatatggcaaagtctcggactcaatgctcgtcagtacg
tgcctcatgctggtgtacatcacaaagtttttctggtgggaatcgggttactggtgcacc
atggacatcgcacacgatcgcgctgggttttacatatgctgggggtgtctcgtctgggtt
ccatcagtttatacttctccagctttgtatctcgttcgtcatcccaatgagcttggtaca
cagcttgctctggccattttggttgcaggccttgcctgtatctatataaactacgactgt
gatcgccaacgccagcatttccgaagcaccaacggaaaatgtacaatatgggggaaagca
ccaggcaagatcgaggccacttacgtgaccgaaaagggagagacaaagaagagcttgctt
ttaacttccggctggtgggggctcgcacgccacttccactacgtcccggaaatatccgcg
gccttcttttggtctgtgcctgctctcttcgaacacttccttccatacttttatgttgtt
tttctcacaattttgctcctggaccgagccgtccgcgacgatcaaagatgccggacgaag
tacaaaaaattctgggacctgtattgccgagaagttccttacaaggtactccctggcgtg
tactaa

DBGET integrated database retrieval system