KEGG   Selaginella moellendorffii: SELMODRAFT_18569Help
Entry
SELMODRAFT_18569  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
smo  Selaginella moellendorffii
Brite
Exosome [BR:smo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SELMODRAFT_18569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 104 aa AA seqDB search
GGGSSKKKRAKRNAESYKTYIFKVLKQVHPDTGISSKAMGIMDSFINDIFEKLAQEASRL
ALYNKKPTVTSREIQTGVRLILPGELAKHAVSEGTKAVTKYTSS
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
ggcggaggatcgagcaagaagaagcgcgccaaacgaaatgctgagagctacaagacgtac
atcttcaaggtgctcaagcaggtccatcccgacacggggatctcgtccaaggccatgggg
atcatggactctttcatcaacgacatctttgagaagctcgcgcaggaggcgtcgcggctg
gcgctctacaacaagaagcccaccgtcacctctcgcgagatccagaccggggtgaggttg
attctcccgggagagctcgccaagcacgccgtctccgaggggaccaaggccgtcaccaag
tacacgagttct

DBGET integrated database retrieval system