KEGG   Selaginella moellendorffii: SELMODRAFT_185926Help
Entry
SELMODRAFT_185926 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
smo  Selaginella moellendorffii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smo00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 476 aa AA seqDB search
MENSRKPMSRMRYNTDLFFLPSWSSLPTVSMGMLARLFYVLLLFLFSRIGGAELPVVSRI
AFGSCAHQDVPQPIWSAVLDFKPEVFIWLGDNIYADNKRPTRVFGKERTAGPWKNIPRFS
PVSLEEMAEKYRKGKSVPEYKRLRATTQIIGTWDDHDYGLNDAGKEFEGKRESQKLMLEN
LDEPLDSPRWSQEGVYTSYSYGPLGKRIKVILLDTRYHRDPIFSDGTVLGEKQWTFLEKE
LTETDAQINIIASSIQVLGNFSSTVRPFFHVEAWSHFPKEQERLFDVIARSNASGVVFIS
GDVHFGEITRYDCGISYPLYDVTSSGLTQAVEQSKLAPLARFSAWLMPTSMRVYNQWCRY
SSCVYGKQNFGTFLIDWTADNVKIIAEIRDVFGRPALKEIIPLSKLQAQDGAERNFKRLK
KKIQRHCTREVDLPWYLRYRLAAVVYSLFTVVILAVSVSLYCLVRVGSSKLHKKSE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagaattcccggaagccgatgtctagaatgaggtataataccgatctcttctttcta
ccaagctggtcgtctctgcccactgtgagcatgggaatgctagctcgtctcttttatgtt
cttcttctcttcctcttttctcgcattggaggggcggagcttcctgttgtatccaggatt
gcttttggttcgtgtgctcatcaggacgttcctcagccgatatggtcggctgtgctggat
ttcaagccggaggtgtttatctggcttggagacaacatttacgcggataacaagcggccg
actcgggtgtttggaaaggaacgcactgctgggccttggaagaacatcccccgcttctct
cctgtgtcgcttgaagaaatggcggagaagtatcggaaagggaagagcgttcccgagtac
aagagattgagagcaactacacagattataggaacttgggatgaccatgattatggcctc
aatgacgctggaaaggagtttgaaggcaagagggagagccaaaagttaatgctggagaat
ttggacgagcctttggacagccccagatggtcccaggagggggtctatacgtcttactct
tatggtcctttaggaaagagaattaaggttattcttctagatacaaggtaccacagagat
ccgattttcagcgacgggacggtgctgggagaaaagcagtggacgtttctggagaaagaa
ctgaccgagaccgatgcgcaaatcaatatcatagcttcgtccattcaagtgttgggcaac
ttttcttcgactgtgcgacctttctttcacgtggaagcatggtcgcattttccaaaagag
caagaacgactttttgatgtaattgcacgctcgaatgcaagtggtgttgtctttatcagt
ggggatgtgcactttggggaaatcactaggtacgactgtggtatcagctacccgctttat
gatgtgacatcgagtggccttacacaggcagtggagcagtctaagcttgctccgctagca
aggttctctgcctggctaatgccaactagtatgagagtatacaaccaatggtgccgatac
agctcttgcgtttatggcaaacaaaacttcggaactttcctcatcgactggaccgcggac
aatgtcaaaattatcgcggagatcagagacgtgtttggacggcctgcgctcaaggagatc
atcccgctctcgaaactccaggcacaagatggagcagagagaaacttcaagcggctaaag
aagaagatccagaggcactgtacacgggaagtcgaccttccgtggtacctgagataccga
ctggctgccgtcgtttactctctcttcactgtggtcatactggctgtttctgtttccctt
tactgtctggtgagagtgggaagcagcaagcttcacaagaagtccgagtga

DBGET integrated database retrieval system