KEGG   Selaginella moellendorffii: SELMODRAFT_2133Help
Entry
SELMODRAFT_2133   CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 303 aa AA seqDB search
GFKNLGNTCYLNSVLQCLTYTPPLANYCLRGQHSKQCDGANSACPFCMLENRISRSFDIE
VPVDAPQRIYKYLQTFAKHFRAGRQEDAHELLRYAIDACDSACARLQKRGSKSSDQTVMK
EIFGGFLQSQIWCLSCNAVSSKLDSVMDLSLDIVRTKTLKEAICNFFQPEVLDGNNKYQC
EKCKKLSVARKQLSIYQSPNVLVIQLKRFENFLGGKIDTHVEFEEELKLRSHMSKNSPDV
HPDYSLYAVVVHSGFSQYGGHYYAYVKDPRGQWYCCNDSFVSAASSATVLSERVYILFYV
RDS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gggtttaagaatctcggcaacacttgctacttgaacagcgtacttcagtgcctgacttac
actccgccgctcgcgaactattgcctccggggccaacattccaagcaatgtgatggagcc
aactctgcctgcccgttttgcatgttggagaacaggatttctcggtcgttcgatattgag
gtgccggtcgatgccccgcaacggatatacaaatacctccagacgtttgcgaaacatttt
cgggctggacggcaggaagacgctcacgagcttttgagatacgccatagatgcatgcgac
agcgcctgtgcgcggctccagaaacgcggttcgaagagctccgaccagaccgtgatgaag
gagatttttggaggatttttgcagagccaaatctggtgtttgtcgtgcaacgcagtgtct
agcaagctggacagcgtcatggacctcagcctggacatcgtacgaactaagaccttgaag
gaagccatctgcaatttcttccagccggaggttttggacggcaacaataaatatcagtgt
gagaagtgtaaaaagctttcagtcgcaaggaagcagctgtcgatatatcagtctcctaat
gttctcgtcatccagttgaagaggtttgagaattttctgggcggcaaaattgatacccac
gtagagtttgaagaagagctgaagcttcgaagccacatgtcaaaaaatagtccggatgtg
catcccgattattctctgtatgctgtagtagtccattctggattctcgcaatatggtggg
cattattatgcttatgtcaaggaccctcgaggacaatggtattgctgtaacgattctttc
gtttcagccgcctccagcgcgactgtattgtcggagagagtctatatacttttctacgtc
cgggattct

DBGET integrated database retrieval system