KEGG   Selaginella moellendorffii: SELMODRAFT_228509Help
Entry
SELMODRAFT_228509 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
smo  Selaginella moellendorffii
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:smo03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 323 aa AA seqDB search
MDPAVLDDLIGRLLEVRSGRPGKQVQLLESEVRQLCVVSKDIFMSQPNLLELEAPIKICG
DIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRG
NHECASINRIYGFYDECKRRFNIKLWKIFTDCFNCLPVAALIDEKILCMHGGLSPHMKTL
DQIKRIPRPTDVPDSGLLCDLLWSDPDKGVDGWGQNDRGVSFTFGSNAVAEFLQKQDLDL
ICRAHQVVEDGYEFFANRQLVTIFSAPNYCGEFDNSGAMMSVDDTLMCSFQILKPAEKKP
KMSTGHPNLARPGTPPRGLKARV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggatccggcagtgctcgacgatttgatcgggcggctgctcgaggtgcgcagtggccgc
ccggggaagcaggtccagctcttggaatcggaggtgcggcagctttgtgtggtctccaag
gacatcttcatgtcgcagcccaatcttctggagctcgaggcgcccatcaaaatctgtggt
gacatccacggccagtactcggatctcttgagactgtttgagtatggtggctttcctccc
gaggccaactacttgttcctgggtgactatgttgatcgtgggaagcagagcttagagacg
atatgcctgcttctggcctataagatcaaatacccggagaacttcttcctgctcaggggt
aatcacgaatgcgcctccatcaatcgtatatatggcttttatgacgagtgcaagcgcagg
ttcaacattaagctatggaagatttttacagattgcttcaattgcctcccggtggctgcg
ctcatcgacgagaaaatcctgtgcatgcacggtggcctctctccccacatgaagaccttg
gatcagatcaagagaatccccaggcccaccgacgtaccagattccggtctcttgtgtgat
cttctatggtccgaccccgacaaaggtgttgacggctggggtcagaatgatcgaggtgtc
tcatttacatttggtagcaacgcggttgcggagtttcttcaaaagcaggacctcgatctc
atttgtcgagctcatcaggtggtggaagacggatacgagtttttcgccaacagacaactt
gtgacgatattttcggcacccaactattgtggggagttcgacaattcaggcgctatgatg
agcgttgacgacacactaatgtgctcgtttcagatacttaagccagcggagaagaagcct
aagatgtcaactggccatcccaatctagctagaccaggaactccacctcgcggattaaag
gcaagagtgtga

DBGET integrated database retrieval system