KEGG   Selaginella moellendorffii: SELMODRAFT_229034Help
Entry
SELMODRAFT_229034 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
smo  Selaginella moellendorffii
Pathway
smo00860  Porphyrin and chlorophyll metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
Module
smo_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SELMODRAFT_229034
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SELMODRAFT_229034
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     SELMODRAFT_229034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 DAO HI0933_like FAD_oxidored Pyr_redox_2 Thi4 Pyr_redox FAD_binding_3 IlvN ApbA Pyr_redox_3 AlaDh_PNT_C GIDA 3HCDH_N MCRA NAD_binding_9 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 9644791
NCBI-ProteinID: XP_002984571
JGI: 229034
UniProt: D8SMN7
Position
Unknown
AA seq 514 aa AA seqDB search
MAMAEGETVPVLGSVAVVGAGASGLAAAYRLRAAGVSVTVYEAENSIGGKLKSVSENGFI
WEKGPNTMTENDPSISRMFDDLHLRDKQQFPVEQKKRYIVRNASPTMLPSNPLGFITTGL
FSAQAKLKLLTEPFSWKRTKAESNEDESVGAFMERHFGDEIVDYAVDPFVAGTSGSDPSS
ISIRHSFPELWSLEKNYGSLFVGAIKSGFSKKKKQKLRPVEFEDEDSDFPARTRPRRGGS
FSFVGGMQTLANELVSRIGKEKFKLNTFVTGLACNQQGNPSRQSWTVTGLETSGKRSKRS
DKTFDAVIMTAPVDDVRTMKVVKDGKPYALDYLPTVIYEPMSVLITMFNKDSVKRALPGF
GVLVPSKEQQANGFQTLGTLFSSFMFPDRAPEDQLLFTTFIGGSRNTLLASRSKEELLDV
TLKDLSRLIGVEGQPTAMRHVYWEKAFPRYSIGYDNVLNSIQKLESDLPGLFYAGNHRGG
LAVGKTIVSGLDAAEQVLQYLQGSGGKKVFTMAS
NT seq 1543 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcggagggagagactgttcccgttcttggatcggtcgctgtcgttggagcg
ggcgcgagtggcctcgcagcagcgtatcgattgcgagctgcgggggtctccgtgacggtc
tatgaagcggaaaattccatcggtgggaagttaaagagtgtttcggagaatggattcatc
tgggagaagggaccgaacacaatgacggaaaatgatccaagcataagcaggatgtttgac
gatctccatcttcgcgataagcaacagtttccggtggagcaaaagaaacgatacattgtt
cgcaatgcttctcctacgatgttgccctctaatcctttgggatttatcactaccggtctc
ttctctgctcaagccaagcttaaacttttgacggagccgttttcatggaagcgaacgaaa
gcagaatcaaacgaagacgagagtgtaggagcgttcatggagaggcactttggtgacgag
atcgtagattatgcagtggatccatttgttgccgggacaagtggttcggatccttcctct
atatcaatccgtcactcgtttccagaattgtggtccttagagaagaactatggatcgctc
ttcgtcggtgcaattaaatcaggttttagcaagaagaagaagcaaaaattgcgaccagtg
gagtttgaagacgaagattctgatttccctgctcgtacacgtccccgtcgtggaggatcg
ttttcatttgtaggtggcatgcagacgctggccaatgaactggtctcgaggattggaaag
gaaaaattcaagctcaatacatttgtcaccggattggcatgtaaccaacagggcaatccc
tctcgtcaaagctggacagtaacaggtttggaaacatcgggcaagagaagcaaacgctcg
gacaaaaccttcgatgcagtcatcatgacggcaccggtggacgatgtgaggacaatgaag
gttgtcaaagatggaaagccttatgctcttgattatctcccaacagttatctacgaacca
atgtccgtgttgataacaatgttcaacaaagactccgtgaagcgtgcacttccgggtttc
ggtgtgctggttccctccaaagagcaacaagcaaatggctttcaaacactgggcaccttg
ttctcttcattcatgtttcctgatagagctccagaagaccagctgctgtttacgactttt
ataggaggcagcaggaatacattgctagcatcacggtcgaaggaagagctccttgatgta
actttgaaggatttgtctagactaattggagtagagggtcaaccaactgctatgaggcat
gtgtattgggaaaaggcgttcccacgatacagcatcggctatgataatgtcttgaattct
atccagaaactcgagagcgacctccctggactcttctacgctggaaatcatcgaggagga
ttggccgttgggaaaacaattgtctcaggccttgacgcagcggagcaagtgctccaatac
ctccaaggctctggaggcaagaaagttttcacaatggcgtcgt

DBGET integrated database retrieval system