KEGG   Selaginella moellendorffii: SELMODRAFT_229487Help
Entry
SELMODRAFT_229487 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
smo  Selaginella moellendorffii
Pathway
smo00900  Terpenoid backbone biosynthesis
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
Module
smo_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SELMODRAFT_229487
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SELMODRAFT_229487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C NAD_binding_3
Motif
Other DBs
NCBI-GeneID: 9628950
NCBI-ProteinID: XP_002989706
JGI: 229487
UniProt: D8T2C2
Position
Unknown
AA seq 488 aa AA seqDB search
MALEAVFSNAGGRIGSTAHGDLQQLSSSSSSCFTGRKLAVTGAQCGTSSSTQECSRNAGS
SKIRCSSNGPPSAWPGRAMVDGARKKSWDGPKPISLLGSTGSIGTQTLDIVSENPDRFKV
VGLAAGSNVTLLADQVRRFKPSMVGIRDASLIDELKEAIADLDVKPEIVVGDEGTVQIAC
HPEAVEVVTGIVGCAGLKPTVAAIAAGKDIALANKETLIAGGPYVLPLAKKHGINILPAD
SEHSAIFQCIQGLPEGGMRRIVLTASGGAFRDWPVERLKDVKPADALKHPNWSMGKKITV
DSATLMNKGLEVIEAHYLFGADYDDIDIVIHPQSIIHSMIETQDSSILAQLGWPDMRLPI
LYTLSWPDRVPCSEITWPRLDFVKTGSLTFKAPDRAKYPSMDISYAAGRMGGTMTGVMSA
ANEKAVELFLDEKIGYFDIIRLIEKTCETHKRDFVKEPSLDDILTSDRWARIYAAEVAAQ
APPQPVPV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctttggaggctgtttttagcaatgctggagggcgcatcgggagcacggcgcatggg
gatttgcagcagctgagctcgagctccagttcgtgtttcacagggaggaaattggcagta
acaggcgctcaatgtggtacctcctccagtacgcaagagtgctcaagaaatgctggttcc
tctaagatacgctgctcgtcaaatggtcccccctcagcttggccaggcagagcaatggtg
gatggagctagaaaaaaatcctgggatggaccaaagcccatttcacttcttggatccacg
ggctccatcggcacacagacacttgacatcgtctcggaaaatcctgacagattcaaagtt
gttgggctggctgctggctcaaacgttacacttcttgctgatcaggtcaggagattcaaa
ccaagcatggttgggattcgagacgcatcgctaatcgacgaattgaaagaagccattgct
gatcttgacgtaaaaccagagattgtcgttggggacgaaggaactgtacagatagcgtgt
catccagaggcagtagaagttgtgacaggaatcgttggctgtgctggcctcaagcctaca
gtagcggcaatagcagctggaaaggatattgctctagccaacaaggaaactctcatagcc
ggcgggccatatgttctacctcttgcaaagaaacacggaatcaacatcctacctgcggac
tcggaacattccgcaattttccagtgcattcaggggcttccagagggcggaatgcgtagg
attgttctcacagcatctggtggagcgttcagggactggccagtggaaaggctcaaggac
gtcaaaccagcagatgcgctgaagcatccaaactggagtatgggaaagaaaattactgtg
gattcggcaaccttgatgaacaagggactcgaggtcattgaagctcactatttgtttgga
gctgactatgatgacattgacattgttatccatccccaatcgattatacactccatgatc
gagacacaggattcctccatcctggcgcaattggggtggcctgacatgcgactacctatt
ctttacacactctcttggccggatagagttccatgctcagaaatcacctggccaaggctt
gactttgtcaagactggatcgctaacgttcaaagcccccgaccgagcaaagtatccatcc
atggacatatcctacgcagctggaagaatgggaggaacaatgacaggagtcatgagcgcg
gccaacgagaaagcagtggagctcttcctagacgagaagattggttatttcgacatcatc
agattgatcgagaagacttgcgaaacgcacaagcgagattttgtcaaggagccaagcctg
gatgatatcctcacatccgaccgatgggcccggatttacgctgcggaagtcgcggcacag
gcccctccgcaacctgtaccggtatga

DBGET integrated database retrieval system