KEGG   Selaginella moellendorffii: SELMODRAFT_229643Help
Entry
SELMODRAFT_229643 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
smo  Selaginella moellendorffii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SELMODRAFT_229643
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SELMODRAFT_229643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 488 aa AA seqDB search
MALEAVFSNAGGRIGSTANGDLQRLSSSSSSCFTGRKLAVTGAQCGTSSSTQECSRNAGS
SKIRCSSNGPPSAWPGRAMVDGARKKSWDGPKPISLLGSTGSIGTQTLDIVSENPDRFKV
VGLAAGSNVTLLADQVRRFKPSMVGIRDASLIDELKEAIADLDVKPEIVVGDEGTVQIAC
HPEAVEVVTGIVGCAGLKPTVAAIAAGKDIALANKETLIAGGPYVLPLAKKHGINILPAD
SEHSAIFQCIQGLPEGGMRRIVLTASGGAFRDWPVERLKDVKPADALKHPNWSMGKKITV
DSATLMNKGLEVIEAHYLFGADYDDIDIVIHPQSIIHSMIETQDSSILAQLGWPDMRLPI
LYTLSWPDRVPCSEITWPRLDFVKTGSLTFKAPDRAKYPSMDISYAAGRMGGTMTGVMSA
ANEKAVELFLDEKIGYFDIIRLIEKTCETHKRDFVKEPSLDDILTSDRWARIYAAEVAAQ
APPQPVPV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctttggaggctgtttttagcaatgctggagggcgcatcgggagcacggcgaatggg
gatttgcagcggctgagttcgagctccagttcgtgtttcacagggaggaaattggcagta
acaggcgctcaatgtggtacctcctccagtacgcaagagtgctcaagaaatgctggttcc
tctaagatacgctgctcgtcaaatggtcccccctcagcttggccaggcagagcaatggtg
gatggagctagaaaaaaatcctgggatggaccaaagcccatttcacttcttggatccacg
ggctccatcggcacacagacacttgacatcgtctcggaaaatcctgacagattcaaagtt
gttgggctggctgctggctcaaacgttacacttcttgctgatcaggtcaggagattcaaa
ccaagcatggttgggattcgagacgcatcgctaatcgacgaattgaaagaagccattgct
gatcttgacgtaaaaccagagattgtcgttggggacgaaggaactgtacagatagcgtgt
catccagaggcagtagaagttgtgactggaatcgttggttgtgctggcctcaagcctaca
gtagcagcaatagcagctggaaaggatattgctctagccaacaaggaaactctcatagcc
ggcggtccatatgttctacctcttgcaaagaaacacggaatcaacatcctacctgcggac
tcagaacattccgcgattttccagtgcattcaggggcttccagagggcggaatgcgtagg
attgttctcacagcatctggtggagcgttcagggactggccagtggaaaggctcaaggac
gtcaaaccagcagatgcgctgaagcatccaaactggagtatgggaaagaaaattactgtg
gattcggcaaccttgatgaacaagggactcgaggtcattgaagctcactatttgtttgga
gctgactatgatgacattgacattgttatccatccccaatccattatacactccatgatc
gagacacaggattcctccatcctggcgcaattggggtggcctgacatgcgactacctatt
ctttacacactctcttggccggatagagttccatgctcagaaatcacctggccaaggctt
gattttgtcaagactggatcgctaacgttcaaagcccccgaccgagcaaagtatccatcc
atggacatatcctacgcagctggaagaatgggaggaacaatgacaggagtcatgagcgcg
gccaacgagaaagcagtggagctcttcctagacgagaagattggttatttcgacatcatc
agattgatcgagaagacttgcgaaacgcacaagcgagattttgtcaaggagccaagcctg
gatgatatcctcacatccgaccgatgggcccggatttacgctgcggaagtcgcggcacag
gcccctccgcaacctgtaccggtatga

DBGET integrated database retrieval system