KEGG   Selaginella moellendorffii: SELMODRAFT_229879Help
Entry
SELMODRAFT_229879 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
smo  Selaginella moellendorffii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SELMODRAFT_229879
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SELMODRAFT_229879
   00630 Glyoxylate and dicarboxylate metabolism
    SELMODRAFT_229879
Enzymes [BR:smo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SELMODRAFT_229879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 556 aa AA seqDB search
MENGYSSKSLPLDAPAGIRIRGPLSDPSLNRILSREALQFVADLEREFRPRVKFNLGCRR
EEQARYDSGELPGFDPATRELREGDWSCSKTPAVIADRRVEITGPVERKMIINALNSGAK
VFMADFEDSLSPTWDNIVRGQKNLCDAVNRSISFEDKARNKHYKLNDKTAVLFVRPRGWH
LQEAHIEIDGEPATGALIDFGLYYFHNHSSFRSKHDGYGPFFYLPKMQHSREAAVWNAVF
DRAEERMAAPRGSIRATVLIETLPAVFQMHEILYELREHSAGLNCGRWDYIFSFVKTVRA
HPDRLLPDRFQVGMTQHFLKSYTELLIKTCHRRGVHAMGGMAAQIPIRDDPAANDTAFEL
VRADKLREVKAGHDGTWAAHPGLIELVTKVFDDNMPRANQLHIKRDDVHVTEADLLQMPR
GVRTLEGLRHNTRVGIQYLAAWLTGTGSVPLYNLMEDAATAEISRVQNWQWIKYGAVLDG
EIVAVSVSKELFGRVVEEEIGRIEREVGKKRFESGRYREAAALFARQCTKEDLDDFLTLD
AYRRIVKFVPALQARL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggagaatggctactcttccaaatcgcttccgctggacgcgccagcgggcatccggatc
cgcgggcctctctcggatccctccctcaaccggatcctcagccgcgaggcgctccagttc
gtggcggatttggagcgcgagtttcgcccgcgcgtgaaattcaacctgggatgccggcgg
gaggagcaagcgcgctacgatagcggcgagctgccagggttcgatccagccacgcgggag
ctccgcgagggcgattggagctgctccaagacgccggccgtgatcgcggatcgccgggtg
gagatcactggccccgtggagcgcaagatgatcatcaatgccctcaactcgggcgccaaa
gttttcatggccgatttcgaggattccctctctccaacctgggacaacatcgtgcgcggc
cagaagaatctctgcgacgctgtgaatcgatccatctccttcgaggacaaggccaggaac
aagcactacaagctcaatgacaagaccgcggtgctcttcgtccgcccccgcggctggcac
ctccaggaagcccacatcgagatcgatggcgagcccgccactggcgcgctcatcgatttc
ggcctctactacttccacaatcactcctccttccgatccaagcacgacggctatggcccc
ttcttctacctcccaaagatgcagcactcgcgcgaggccgcggtgtggaacgccgtgttt
gatcgagccgaggagaggatggccgcgccgcgcggtagcatccgcgcgacggtgctgatc
gagacgctgccggcggtgttccagatgcacgagatcctctacgagctgcgcgagcactcg
gccggattgaattgcgggcgctgggactacatctttagcttcgtcaagacggtgcgcgct
caccccgatcgactgctgcccgatcgcttccaggtggggatgacccagcacttcctcaag
agctacacggagctgctcatcaagacgtgccatcgccgcggtgtccacgccatgggagga
atggccgcgcagatccccatccgcgacgatcccgccgccaacgacaccgccttcgagctc
gtccgcgcggacaagctccgcgaggtgaaggccgggcacgatggaacctgggcggcgcat
cccggactgatcgagctggtgaccaaggtcttcgacgacaacatgccgcgcgccaaccag
ctccacatcaagcgtgacgacgtgcacgtcacggaggccgacctcctccaaatgccgcgc
ggcgtgagaaccctagagggcctgcgccacaacacacgtgtcggcatccagtacctcgcc
gcgtggctcacggggactggctccgtaccgctctacaatctcatggaggacgcggcaacg
gcggagattagccgggtccagaactggcagtggatcaagtatggcgccgtgctggatggc
gagatcgtggccgtcagtgtgagcaaggagctatttgggcgagtcgtggaggaggagatc
gggaggatcgagagagaggtggggaagaagaggtttgagagtgggcgatatcgtgaggcc
gcggcattgtttgcgaggcagtgcaccaaggaggatctggacgatttcctcacgctggat
gcgtatcgacgcattgtcaagtttgtgccagcgctccaggcgcgtttgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system