KEGG   Selaginella moellendorffii: SELMODRAFT_230384Help
Entry
SELMODRAFT_230384 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
smo  Selaginella moellendorffii
Pathway
smo00010  Glycolysis / Gluconeogenesis
smo00052  Galactose metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELMODRAFT_230384
   00052 Galactose metabolism
    SELMODRAFT_230384
Enzymes [BR:smo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SELMODRAFT_230384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 9654816
NCBI-ProteinID: XP_002964577
JGI: 230384
UniProt: D8R045
Position
Unknown
AA seq 359 aa AA seqDB search
MASDSKCVDVEAWGRKPGVYLYTLRNGGITARITNWGATIVSLCLRDPSAGEDIDIVLGF
DSCDPYMDGTSPYFGCIVGRVANRIKDASFSMDGVTYTLPANNNMNTLHGGEVGYDKVLW
QSQIVKESQVPAVEFTYRSSDGEQGFPGELDVSVTYALHENELRVEMRAVPASKQTPVSL
AQHTYWNLAGHKSGSILDHTICISASRYTPVDDFQIPTGELAPVAGTAFDFLQEARIGSR
IDQVEGGYDHNYVLDQKQGPGLCFAARVRDPSSGRTMELLTDAPGLQFYTGNFLVAEAGK
DGQVYRKHAGLCLETQGFPNAVNDARFPSVMVSPGEVYRHQMVFRFSVTRKEKTKCLLE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtgatagcaagtgtgtagatgtggaggcttgggggcgcaagccgggggtctat
ctgtacaccttgaggaatggaggcatcactgccaggatcacgaactggggagcgaccatc
gtctcgctctgcctcagggatccttcagctggagaggacattgatatcgttctgggattt
gattcctgcgatccttacatggatggaacctcgccgtattttggatgcattgttggtcgc
gtagcgaaccggatcaaagacgcatctttttccatggatggagtcacgtacactctgcct
gccaataacaacatgaacactcttcatggtggtgaagttggatatgacaaagtgctgtgg
cagtcgcaaattgtcaaggaatctcaggtcccagcggtcgaatttacgtaccgcagcagc
gatggcgagcaaggattcccgggcgagctggacgtttcagtaacttatgctcttcacgag
aacgagctgcgcgtggaaatgagagctgtgccggcgagcaagcaaactccggtcagcctt
gcgcagcacacgtactggaacctggcggggcacaagagcggcagcatcctcgaccacacc
atttgcatctcggcctctcgctacactccagtggacgacttccagattcccactggcgag
ctcgcccccgtcgcaggcaccgcctttgatttcctgcaagaggccaggatcggttccagg
attgatcaagtcgaggggggatacgatcacaactacgtgctggatcagaagcaaggacct
gggctttgctttgctgccagggtgagagatccatccagtggaagaacgatggagcttctc
acggacgcgccgggcttgcagttctacacggggaacttcttagtggcagaggctggaaaa
gatggacaggtttacaggaagcacgccgggctttgcctcgagacgcagggatttccaaat
gccgttaacgacgcaaggttcccgagcgtgatggtttcccccggggaagtttacaggcac
cagatggtgtttagattctccgtgacacgaaaggaaaaaacaaagtgtttgctcgagtga

DBGET integrated database retrieval system