KEGG   Selaginella moellendorffii: SELMODRAFT_231325Help
Entry
SELMODRAFT_231325 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SELMODRAFT_231325
Peptidases [BR:smo01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   SELMODRAFT_231325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 324 aa AA seqDB search
MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLESLSLLRPVYGLIFLFKWRPGEKDT
RPTVKDNKSIFFASQVINNACATQAILSILMNRVEIDIGPELSMMREFAKDFPPELKGLT
INNSEAIRTAHNSFARPEPFVPDEQKFADKDDDVYHFISYLPVDGVLYELDGLKEGPISL
GECGSGDADSMEWLKMVQPVIQERIEKYSKSEIRFNLMAVIKNRKDLYNQQLAELDKRKT
EISGDDGMDVDSKSGSGNEELAQIDAEIARLTEKITQEDEKFKKWKTENIRRKHNYIPFL
FNFLKILAEKKQLKPLIEKARQKT
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggtgcacgattgaatccgacccaggcgttttcacggagctcatccagcaaatg
caagtcaagggcgtccaggtggaggagctctacagcttggatttggaatcgctctcgttg
ctccggcctgtctatggactaatctttctcttcaaatggaggcctggggagaaagatact
cggcccactgtgaaggacaacaaatcgatttttttcgcgagccaggttataaacaacgct
tgcgctactcaagcaatactttcgatcctgatgaacagagtggagatcgatattggtccc
gagctttcgatgatgcgagagttcgccaaggatttccctccggagctcaagggcctgacc
atcaacaacagcgaggccattcgcactgctcacaacagctttgcgaggccggagcctttt
gttcccgacgagcaaaagtttgcggacaaagacgacgacgtctatcacttcatcagctat
ctcccggtggacggtgttttgtacgagctggacggactcaaggaagggccgatcagtctg
ggcgagtgtggcagtggagacgctgatagcatggagtggctcaagatggtccagccagtg
atccaagagaggatcgagaagtactccaagagcgagatccgcttcaacctcatggccgtg
atcaagaacaggaaggatctctacaaccagcagctggcggagctcgacaagcggaaaacc
gagataagtggcgacgacggcatggacgtcgactccaagagcggcagcggcaacgaggag
ctggcacagatcgacgcggagatcgctcgactgaccgagaagatcactcaagaggatgaa
aagttcaagaagtggaagactgagaacatccggaggaagcacaactacatccccttcctc
ttcaacttcctcaagatcctggcagagaagaagcagctcaagccgctgattgaaaaggcc
aggcagaagacatag

DBGET integrated database retrieval system