KEGG   Selaginella moellendorffii: SELMODRAFT_232533Help
Entry
SELMODRAFT_232533 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
Organism
smo  Selaginella moellendorffii
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_14
Motif
Other DBs
NCBI-GeneID: 9630024
NCBI-ProteinID: XP_002975660
JGI: 232533
UniProt: D8RWP0
Position
Unknown
AA seq 472 aa AA seqDB search
MLPLDSVNVNNTLNRRRALNAGLIALKSAGVEGVMVDVWWGIVEREKPHHYKWSAYKELV
SLIQKNGLKIQVVMSFHQCGGNVGDSCYIPLPLWVLEEVQNNPNIVYTDKSGNRNHEYLS
LGCDFLPVLRGRTPIQAYSDFMRSFKHVFKDVLGETIVEVQVGLGPAGELRYPAYPEYNG
KWRFPGIGEFQCYDKYMLASLRACATACGTKHWGQGGPHDAGHYNQWPDDTGFFNRDGSW
NSPYGQFFLEWYSGMLISHGERVLSAAEAVFRGAGIKLAGKVAGVHWHYGTKPHPAELTA
GYYNTRLRDGYTGLARMFGRHGAVMIFTCLEMRDLEQPPHALSSPESLLHQVVSACKQAG
ISLAGENALPRFDEAAYEQVVKKSRMQESEEEDDWISASSGGCSSTACEPMCSFTFLRMS
EKLFYSENWHNFVPFVRRMAGGRAFQEEHHDTESHMHATRPVQEAAAALMCH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctctcgacagcgtcaacgtgaacaacaccttaaaccggaggagggccttgaac
gcggggctgatagcgctcaagagtgctggagtggagggcgtgatggtggacgtctggtgg
gggattgtagagcgagaaaagcctcatcactacaagtggtccgcttacaaggagcttgtg
tccttgatccaaaagaatggactcaagattcaagttgtcatgtcgtttcaccagtgtgga
ggcaacgttggcgattcttgctatatacctttgccactgtgggtgcttgaggaggtccaa
aacaatccgaacattgtgtacacggacaagtctggcaacaggaaccatgaatatctttcg
ctcggctgtgactttcttcctgttttacgcggtagaactcctatccaggcctactccgac
ttcatgcgtagcttcaaacacgtattcaaagatgttcttggcgagactatcgtggaagtc
caagtaggacttggtcctgccggggagctccggtacccggcctatcccgaatacaatgga
aaatggagatttcccggtattggcgagtttcagtgctatgacaagtatatgttggcaagt
ttaagagcttgtgcgactgcctgtggaacaaagcactggggacaaggaggccctcacgac
gccggtcactacaaccagtggccagacgatacggggtttttcaacagagacggctcatgg
aactcgccttacggccagttctttctcgagtggtactccgggatgctcatctctcacggt
gagcgtgttctctccgcggccgaggccgtcttccggggggcggggatcaagctcgcaggg
aaagtggcaggagttcactggcactacgggaccaagcctcatcccgcggagctcaccgcc
gggtactacaacactcggcttagagacggatacactggcctggctcggatgtttggacgt
cacggggcggtcatgatcttcacttgcttggagatgcgcgacttggagcagccccctcac
gcgctctcgagcccagagagcttgctccaccaggtggtctcggcatgcaagcaagcaggg
atctctctggcgggagagaacgctctccctcgattcgacgaggctgcgtacgaacaggtg
gtgaagaagtcccggatgcaagagagcgaggaggaggacgactggatttccgcgagctct
ggcggctgctcgtccacggcgtgcgagcctatgtgctcgtttacgttcttgaggatgagc
gagaagctgttttacagcgagaactggcacaacttcgtcccgtttgtgaggaggatggcc
ggcggccgggcatttcaggaagaacaccacgacaccgagtcacacatgcacgctaccagg
cctgtacaagaagctgctgccgctttgatgtgtcactag

DBGET integrated database retrieval system