KEGG   Selaginella moellendorffii: SELMODRAFT_232944Help
Entry
SELMODRAFT_232944 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 218 aa AA seqDB search
MSWRCHGRSNEELIANLQKNGILSSAAATDAMARIDRAFFVPRGGSPYQDAPQPIGHGAT
ISAPHMHGYCVSMLADHLKPGMAVLDVGSGSGYLTAVFALMVGQTGKAVGIEHIPELVES
SIKNIRRTPAVSLLDAGALSVHAGDGKLGFPACSPYDAIHVGAAAAEMPQALVDQLKPGG
RMVIPVGRFLQDLVVIDKLSDGSIKKRTEMGVSYVPLV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagctggaggtgccacggcaggagcaacgaggagctgatcgcaaacctccagaagaat
ggaatcctgagctctgccgccgcgactgacgcgatggcgaggatcgacagagcgtttttc
gtgccgcggggaggatcgccgtatcaagatgcgccccagccgattgggcacggcgcgaca
atctcagctccacacatgcatggttactgcgtatccatgctcgcggatcatctcaaaccg
ggaatggcagtgcttgatgttggatccggctccggctacttgactgcggtcttcgcgttg
atggttggacaaactggaaaagctgtgggaattgagcacatccccgagcttgtggagtcg
tctataaaaaacatcagaagaacaccagcggtgtcgcttcttgacgctggagctctgtcc
gtccacgctggagatggcaagcttggctttccggcttgttcaccttacgatgcaattcat
gttggagcggcagctgctgaaatgccgcaagcgcttgtagaccagctcaaacccggtggc
cgtatggtgattccagtaggacgcttcttacaggatctagttgtcatagacaaactttca
gacgggtccattaaaaaacgaactgagatgggtgtaagctacgtgcctctcgtgtga

DBGET integrated database retrieval system