KEGG   Selaginella moellendorffii: SELMODRAFT_233670Help
Entry
SELMODRAFT_233670 CDS       T01496                                 

Gene name
DET2B-1
Definition
(RefSeq) hypothetical protein
Organism
smo  Selaginella moellendorffii
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh PEMT DUF1295 ICMT
Motif
Other DBs
NCBI-GeneID: 9657995
NCBI-ProteinID: XP_002981079
JGI: 233670
UniProt: D8SCW6
Position
Unknown
AA seq 220 aa AA seqDB search
MPTLPSHLGWLLMEAPTLLVPALIFHRGKHAAAAAPRLLLLLFLAHYFHRTLLYPLRLSR
RSSSSTPMPLVTAVLAALFNALNTYIQLRWISHFGFYPERWIHSAQFAIGAFLFVAGMAI
NIWADGVLIALRKQRSSAKESVSYRVPYGGLYEFVSCPNYLGEIVEWLGWAILTWSPAGL
GFFLYTVATLAPRACAHHRWYVDKFPDYPRGRTPLIPFLC
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgcttccctcgcatctgggctggctcctcatggaagcgcccacgctcctcgtc
cccgccctaatcttccaccgaggtaagcacgccgccgccgccgccccacggctcctcctc
ctcctctttctcgcccactacttccatcgcaccctcctctatcccctccgcctcagccgc
cgctcctcctcctccacgccaatgccgcttgtcaccgccgttctcgccgcgctcttcaac
gccctcaacacctacattcaactgcgctggatctcccactttggattctaccctgagcga
tggattcacagcgcccagttcgcgatcggcgcattcctgttcgtggcgggcatggcgatc
aacatctgggccgacggcgtgctcatcgcgctgagaaaacaaagatcttccgccaaggag
agtgtgtcgtacagggttccgtacggggggctgtacgagtttgtgtcatgcccaaactac
ctgggcgagattgtggagtggctgggatgggccatactgacgtggtcgccagcggggctg
ggtttcttcctctacaccgttgccacgctggcgccacgtgcctgcgcgcatcaccgttgg
tacgtggacaagttccccgactatccgcgcgggagaacaccgttgattcctttcctctgt
taa

DBGET integrated database retrieval system