KEGG   Selaginella moellendorffii: SELMODRAFT_233670Help
Entry
SELMODRAFT_233670 CDS       T01496                                 

Gene name
DET2B-1
Definition
hypothetical protein
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
smo  Selaginella moellendorffii
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    SELMODRAFT_233670 (DET2B-1)
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     SELMODRAFT_233670 (DET2B-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 220 aa AA seqDB search
MPTLPSHLGWLLMEAPTLLVPALIFHRGKHAAAAAPRLLLLLFLAHYFHRTLLYPLRLSR
RSSSSTPMPLVTAVLAALFNALNTYIQLRWISHFGFYPERWIHSAQFAIGAFLFVAGMAI
NIWADGVLIALRKQRSSAKESVSYRVPYGGLYEFVSCPNYLGEIVEWLGWAILTWSPAGL
GFFLYTVATLAPRACAHHRWYVDKFPDYPRGRTPLIPFLC
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgcttccctcgcatctgggctggctcctcatggaagcgcccacgctcctcgtc
cccgccctaatcttccaccgaggtaagcacgccgccgccgccgccccacggctcctcctc
ctcctctttctcgcccactacttccatcgcaccctcctctatcccctccgcctcagccgc
cgctcctcctcctccacgccaatgccgcttgtcaccgccgttctcgccgcgctcttcaac
gccctcaacacctacattcaactgcgctggatctcccactttggattctaccctgagcga
tggattcacagcgcccagttcgcgatcggcgcattcctgttcgtggcgggcatggcgatc
aacatctgggccgacggcgtgctcatcgcgctgagaaaacaaagatcttccgccaaggag
agtgtgtcgtacagggttccgtacggggggctgtacgagtttgtgtcatgcccaaactac
ctgggcgagattgtggagtggctgggatgggccatactgacgtggtcgccagcggggctg
ggtttcttcctctacaccgttgccacgctggcgccacgtgcctgcgcgcatcaccgttgg
tacgtggacaagttccccgactatccgcgcgggagaacaccgttgattcctttcctctgt
taa

DBGET integrated database retrieval system