KEGG   Selaginella moellendorffii: SELMODRAFT_234034Help
Entry
SELMODRAFT_234034 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
smo  Selaginella moellendorffii
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:smo00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    SELMODRAFT_234034
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     SELMODRAFT_234034
Protein kinases [BR:smo01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   SELMODRAFT_234034
Mitochondrial biogenesis [BR:smo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    SELMODRAFT_234034
  Mitophagy factors
   Other mitophagy factors
    SELMODRAFT_234034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 486 aa AA seqDB search
MDQQQQQQSARRTEFLHYKLGKTLGIGSFGKVKIGEHVLTGHKVAIKILNRRKIRAMDME
EKVRREIKILRLFMHPHIIRLYEVVETSTDIFVVMEFVKSGELFDYIVENGRLQEDEARC
FFQQIISGVEYCHRNMVVHRDLKPENLLLGSKCSVKIADFGLSNIMRDGHFLKTSCGSPN
YAAPEVISGKLYAGPEVDVWSCGVILYALLCGSLPFDDENIPNLFKKIKGGIYTLPSHLS
SGAKDLIPRMLLVDPMKRMTVAEIREHPWFQVNLPRYLAVPPLDSAEQAKRIDEDIANEV
ARLGFEKGQLIDSLRNRVQNPATVTYYLMLDNRKRTGGNGNELSEVQVSRSRVKSGYHQA
CCWNIGSERRWALGLQSRAHPREIMNEVLKVLQELDVSWKKLGHYNVKCRWTFAPPSKAP
CSLPGSPMISEPLHERIAGRRNLVKFELQLYKMHEEKYLLDLQKLEGPFFTFLDFCSMFL
AELRVL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggatcagcagcagcaacagcaatccgcgaggaggaccgaatttctccattacaagctc
gggaagacgctgggaattggctcgtttggcaaggtgaagatcggggagcatgtcctcaca
ggccacaaggttgctatcaagattcttaatcggaggaagattagagccatggacatggaa
gagaaagtgcgcagagaaatcaagatattgaggctgttcatgcatcctcacatcatcagg
ctgtatgaagttgtggagacgagcaccgatattttcgtggtgatggagtttgtcaagtcg
ggggagctcttcgactacattgttgagaatggtcgactccaggaagacgaagctcgttgt
ttcttccagcagattatctcgggtgttgagtactgtcatagaaacatggtcgttcatcgt
gacctcaagccagagaatttgcttctcggctccaaatgcagtgtcaagatagcggatttt
ggcctgagcaacattatgcgagacggacactttctgaaaacaagctgtggaagtccgaac
tatgctgctccagaggtgatttccggtaagctctatgctggaccagaagtagacgtatgg
agctgtggggtgatactatacgcacttctctgtggcagccttccctttgacgacgaaaac
attccaaatctattcaagaaaatcaagggtggcatctacacacttccaagtcatctctct
tctggtgcgaaagacttaatcccgcgaatgttgctggttgatccgatgaagcggatgaca
gttgcggagattcgtgaacacccgtggtttcaagttaatcttcctcggtatcttgccgta
ccacccttggactcggccgaacaagccaagcggattgatgaagatatcgcaaatgaagtt
gcaaggctgggatttgaaaagggtcaacttatagattctcttcgcaaccgagtgcaaaat
ccagcaactgttacgtattatctcatgctggacaatagaaagcgcactggaggcaatggc
aacgagctttcggaagttcaggtaagtcgcagtcgtgtaaaaagtggatatcaccaagca
tgttgctggaacataggatccgagagacgctgggctctgggattgcagtctcgagcgcat
ccgagagagataatgaacgaggtacttaaggtattgcaagaactggacgtaagctggaag
aagctcggtcactacaacgtaaagtgccggtggacgtttgctccaccatcgaaagctccc
tgcagcttgcctggatctccaatgatctcagagccattgcacgagcgcattgctggtcga
cgaaatcttgtcaagttcgagctccaactttataagatgcacgaagagaaatacctgctg
gatctgcaaaagctcgagggcccgttcttcacatttctggatttctgctccatgttctta
gcagagctacgggttctctaa

DBGET integrated database retrieval system