KEGG   Selaginella moellendorffii: SELMODRAFT_234034Help
Entry
SELMODRAFT_234034 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
smo  Selaginella moellendorffii
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:smo04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 486 aa AA seqDB search
MDQQQQQQSARRTEFLHYKLGKTLGIGSFGKVKIGEHVLTGHKVAIKILNRRKIRAMDME
EKVRREIKILRLFMHPHIIRLYEVVETSTDIFVVMEFVKSGELFDYIVENGRLQEDEARC
FFQQIISGVEYCHRNMVVHRDLKPENLLLGSKCSVKIADFGLSNIMRDGHFLKTSCGSPN
YAAPEVISGKLYAGPEVDVWSCGVILYALLCGSLPFDDENIPNLFKKIKGGIYTLPSHLS
SGAKDLIPRMLLVDPMKRMTVAEIREHPWFQVNLPRYLAVPPLDSAEQAKRIDEDIANEV
ARLGFEKGQLIDSLRNRVQNPATVTYYLMLDNRKRTGGNGNELSEVQVSRSRVKSGYHQA
CCWNIGSERRWALGLQSRAHPREIMNEVLKVLQELDVSWKKLGHYNVKCRWTFAPPSKAP
CSLPGSPMISEPLHERIAGRRNLVKFELQLYKMHEEKYLLDLQKLEGPFFTFLDFCSMFL
AELRVL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggatcagcagcagcaacagcaatccgcgaggaggaccgaatttctccattacaagctc
gggaagacgctgggaattggctcgtttggcaaggtgaagatcggggagcatgtcctcaca
ggccacaaggttgctatcaagattcttaatcggaggaagattagagccatggacatggaa
gagaaagtgcgcagagaaatcaagatattgaggctgttcatgcatcctcacatcatcagg
ctgtatgaagttgtggagacgagcaccgatattttcgtggtgatggagtttgtcaagtcg
ggggagctcttcgactacattgttgagaatggtcgactccaggaagacgaagctcgttgt
ttcttccagcagattatctcgggtgttgagtactgtcatagaaacatggtcgttcatcgt
gacctcaagccagagaatttgcttctcggctccaaatgcagtgtcaagatagcggatttt
ggcctgagcaacattatgcgagacggacactttctgaaaacaagctgtggaagtccgaac
tatgctgctccagaggtgatttccggtaagctctatgctggaccagaagtagacgtatgg
agctgtggggtgatactatacgcacttctctgtggcagccttccctttgacgacgaaaac
attccaaatctattcaagaaaatcaagggtggcatctacacacttccaagtcatctctct
tctggtgcgaaagacttaatcccgcgaatgttgctggttgatccgatgaagcggatgaca
gttgcggagattcgtgaacacccgtggtttcaagttaatcttcctcggtatcttgccgta
ccacccttggactcggccgaacaagccaagcggattgatgaagatatcgcaaatgaagtt
gcaaggctgggatttgaaaagggtcaacttatagattctcttcgcaaccgagtgcaaaat
ccagcaactgttacgtattatctcatgctggacaatagaaagcgcactggaggcaatggc
aacgagctttcggaagttcaggtaagtcgcagtcgtgtaaaaagtggatatcaccaagca
tgttgctggaacataggatccgagagacgctgggctctgggattgcagtctcgagcgcat
ccgagagagataatgaacgaggtacttaaggtattgcaagaactggacgtaagctggaag
aagctcggtcactacaacgtaaagtgccggtggacgtttgctccaccatcgaaagctccc
tgcagcttgcctggatctccaatgatctcagagccattgcacgagcgcattgctggtcga
cgaaatcttgtcaagttcgagctccaactttataagatgcacgaagagaaatacctgctg
gatctgcaaaagctcgagggcccgttcttcacatttctggatttctgctccatgttctta
gcagagctacgggttctctaa

DBGET integrated database retrieval system