KEGG   Selaginella moellendorffii: SELMODRAFT_234829Help
Entry
SELMODRAFT_234829 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
smo  Selaginella moellendorffii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smo01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:smo00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 331 aa AA seqDB search
MPETPAEWKGWEEKRIQEEIISKQGISIRRRPPTGPPTHACGPFDFKLQNEGNTPRNILE
EIVWNTEREVTEMKEKTPLSALHKALPAVDPPRDFIGALKARKAETGLPGLIAEVKKASP
SKGVIQPDFDPVRIARGYERGGAACLSGSFENLKAIREAGVQCPLLCKEFIIDAWQLYYA
RIKGADAVLLIAAVLPDQDLLYMTKITKALKMAALVEVHNAVEMDRVLRLPGIQMIGINN
RNLENFEVDITNTESLLQGVRSGIIREKEILVVAESGLSTPDDIALVQNAGVSAVLVGES
LVKQDDPAAGIASLFGKDISRAAQKNETIFA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagaccccggcagagtggaaagggtgggaggagaagcgaatccaggaagagatt
atttccaagcagggtatttcgattcgtcggcggcccccgactggacctccgactcacgct
tgcgggccgtttgattttaaactccagaacgaaggaaatactcctcgaaacatcctcgaa
gagattgtgtggaacacagagcgagaggtcacagagatgaaggagaagacgccgttgagt
gctttgcataaagctttaccagctgttgatcctccgcgggactttataggtgctctaaag
gcgaggaaggctgagacgggattgccaggacttattgccgaagtgaagaaggcatccccg
agcaaaggagtcatccagcccgactttgatccggtgcgtattgcaagaggatatgagaga
ggtggagcggcatgtctcagcgggagctttgagaacttgaaggccattcgtgaagccggg
gttcagtgcccgttgctgtgcaaggaattcattattgatgcctggcaactctactatgct
cgaattaaaggtgctgatgccgttcttttgattgctgctgtgcttccggatcaagatctt
ttatacatgacaaaaattacgaaagctctcaagatggctgcacttgttgaggttcacaat
gcagtggaaatggatcgtgtgctacgtcttccaggaatacaaatgattgggataaacaac
aggaacttagaaaatttcgaggttgacatcacgaacactgagagtttgctacaaggagtg
aggagcggaatcattcgggagaaagagattcttgttgttgctgagtccggactctccaca
ccggacgacatagcgcttgttcaaaatgctggagttagtgcggtactcgtcggagagtcg
ctggtgaagcaagacgatccggcagctggtattgcaagcctttttggaaaggatatcagt
agagcagctcagaagaatgaaacaatcttcgcataa

DBGET integrated database retrieval system