KEGG   Selaginella moellendorffii: SELMODRAFT_2558Help
Entry
SELMODRAFT_2558   CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
Organism
smo  Selaginella moellendorffii
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 350 aa AA seqDB search
LVGLMNEGNTCFLNSCLQCLAHTVPLSSAILGPFSELIQTKGAAARSRRDTASLSEMLAY
SFRQLLKDLCGKPSYSTASASMLLQSLQGLSPQFAGNRQHDAQEAMRTIIDGLHEALNRK
PPGRPKCPEPPPTTPEAEIADICWEHHKMWNNSLTISCLTGQLQSTIECSVCHRKSHCFD
PFLDLSLPLSKSGGSDNFRNFGSSRSRMTIEDCLSAFVAPETLDPSNKYYCSGCKAPQIS
TKKLSIYRAPSVLVLHIKRFYGVEPRSYRKDDRPVVYPLNGLDLSSFMRHFSQQQATYDL
YGVCSHFGSLGYGHYTATCRSVDNGWYCYNDSSVTSVQDPVDSSAYILFY
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ctagtgggtctgatgaacgaggggaacacttgcttcttaaacagctgcttgcagtgcttg
gcacacacagtcccgctctcgtcagcaattctaggaccgttttcggagttgatccaaacc
aaaggtgccgcagcgaggagcaggagagacacggctagcttgtccgaaatgctggcttat
tcttttcgccagcttctcaaggacctttgtggaaaaccatcgtactcgactgccagtgcg
tcaatgcttctacagagcttgcaaggcttgtcaccccagtttgctgggaatcgacaacac
gatgctcaggaggcgatgcgaacaattattgatgggcttcacgaagcattgaatcgaaaa
ccacccgggcgtccaaaatgtccagagcctcctcccacaacaccggaagccgagattgca
gatatttgctgggaacatcacaaaatgtggaacaactcccttacaatttcctgcctgaca
ggacagctgcagagtaccatagaatgctcggtgtgccacagaaagtcgcattgttttgat
cctttcctggatttgtcactcccactttcaaagagcggtggctctgataacttcaggaac
ttcggcagcagccgctcgaggatgacgatcgaggattgtctctcggcgtttgtcgctccc
gagacactggacccgtccaacaagtactattgttccggttgcaaggctccacaaatctct
accaagaaactcagcatttacagggctccttcggtcttagtccttcacatcaagagattc
tatggtgtagaaccacgctcctacagaaaggatgaccggcccgttgtgtatcctctcaat
ggacttgatcttagcagtttcatgaggcatttttctcagcagcaggcaacgtatgattta
tatggtgtttgctcgcattttggatcactaggctatggacactacaccgcgacgtgtaga
agtgttgacaatggctggtattgttacaacgatagtagcgttacttctgtacaggacccg
gttgattcttcagcctacatcctcttttat

DBGET integrated database retrieval system