KEGG   Selaginella moellendorffii: SELMODRAFT_267738Help
Entry
SELMODRAFT_267738 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
smo  Selaginella moellendorffii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SELMODRAFT_267738
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SELMODRAFT_267738
Enzymes [BR:smo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SELMODRAFT_267738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 331 aa AA seqDB search
MPETPAEWKGWEEKRIQEEIISKQGISIRRRPPTGPPTHACGPFDFKLQNEGNTPRNILE
EIVWNTEREVTEMKEKTPLGALHKALPAVDPPRDFIGALKARKAETGLPGLIAEVKKASP
SKGVIQPDFDPVRIARGYERGGAACLSGSFENLKAIREAGVQCPLLCKEFIIDAWQLYYA
RIKGADAVLLIAAVLPDQDLLYMTKITKALKMAALVEVHNAVEMDRVLRLPGIQMIGINN
RNLENFEVDITNTESLLQGVRSGIIREKEILVVAESGLSTPDDIALVQNAGVSAVLVGES
LVKQDDPAAGIASLFGKDVSRAAQKNETIFV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagaccccggcagagtggaaagggtgggaggagaagcgaatccaggaagagatt
atttccaagcagggtatttcgattcgtcggcggcccccgactggacctccgactcacgct
tgcgggccgtttgattttaaactccagaacgaaggaaatactcctcgaaacatcctcgaa
gagattgtgtggaacacagagcgagaggtcacagagatgaaggagaagacgccgttgggt
gctttgcataaagctttaccagctgttgatcctccgcgggactttataggtgctctaaag
gcgaggaaggctgagacgggattgccaggacttattgccgaagtgaagaaggcatccccg
agcaaaggagtcatccagcccgactttgatccggtgcgtattgcaagaggatatgagaga
ggtggagcggcatgtctcagcgggagctttgagaacttgaaggccattcgtgaagccggg
gttcagtgcccgttgctgtgcaaggaattcattattgatgcctggcaactctactatgct
cgaattaaaggtgctgatgccgttcttttgattgctgctgtgcttccggatcaggatcta
ttatacatgacaaaaattacgaaagctctcaagatggctgcacttgttgaggttcacaat
gcagtggaaatggatcgtgtgctacgtcttccagggatacaaatgattgggataaacaac
aggaacttagaaaatttcgaggttgacatcacgaacactgagagtttgctacaaggagtg
aggagcggaatcattcgggagaaagagattcttgttgttgctgagtccggactctccaca
ccggacgacatagcgcttgttcaaaatgctggagttagtgcggtactcgtcggagagtcg
ctggtgaagcaagacgatccggcagctggtattgcaagcctttttggaaaggatgtcagt
agagcagctcagaagaatgaaacaatcttcgtataa

DBGET integrated database retrieval system