KEGG   Selaginella moellendorffii: SELMODRAFT_267738Help
Entry
SELMODRAFT_267738 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
smo  Selaginella moellendorffii
Pathway
smo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01230  Biosynthesis of amino acids
Module
smo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SELMODRAFT_267738
Enzymes [BR:smo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SELMODRAFT_267738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS ThiG NanE His_biosynth
Motif
Other DBs
NCBI-GeneID: 9657390
NCBI-ProteinID: XP_002974217
JGI: 267738
UniProt: D8RT35
Position
Unknown
AA seq 331 aa AA seqDB search
MPETPAEWKGWEEKRIQEEIISKQGISIRRRPPTGPPTHACGPFDFKLQNEGNTPRNILE
EIVWNTEREVTEMKEKTPLGALHKALPAVDPPRDFIGALKARKAETGLPGLIAEVKKASP
SKGVIQPDFDPVRIARGYERGGAACLSGSFENLKAIREAGVQCPLLCKEFIIDAWQLYYA
RIKGADAVLLIAAVLPDQDLLYMTKITKALKMAALVEVHNAVEMDRVLRLPGIQMIGINN
RNLENFEVDITNTESLLQGVRSGIIREKEILVVAESGLSTPDDIALVQNAGVSAVLVGES
LVKQDDPAAGIASLFGKDVSRAAQKNETIFV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagaccccggcagagtggaaagggtgggaggagaagcgaatccaggaagagatt
atttccaagcagggtatttcgattcgtcggcggcccccgactggacctccgactcacgct
tgcgggccgtttgattttaaactccagaacgaaggaaatactcctcgaaacatcctcgaa
gagattgtgtggaacacagagcgagaggtcacagagatgaaggagaagacgccgttgggt
gctttgcataaagctttaccagctgttgatcctccgcgggactttataggtgctctaaag
gcgaggaaggctgagacgggattgccaggacttattgccgaagtgaagaaggcatccccg
agcaaaggagtcatccagcccgactttgatccggtgcgtattgcaagaggatatgagaga
ggtggagcggcatgtctcagcgggagctttgagaacttgaaggccattcgtgaagccggg
gttcagtgcccgttgctgtgcaaggaattcattattgatgcctggcaactctactatgct
cgaattaaaggtgctgatgccgttcttttgattgctgctgtgcttccggatcaggatcta
ttatacatgacaaaaattacgaaagctctcaagatggctgcacttgttgaggttcacaat
gcagtggaaatggatcgtgtgctacgtcttccagggatacaaatgattgggataaacaac
aggaacttagaaaatttcgaggttgacatcacgaacactgagagtttgctacaaggagtg
aggagcggaatcattcgggagaaagagattcttgttgttgctgagtccggactctccaca
ccggacgacatagcgcttgttcaaaatgctggagttagtgcggtactcgtcggagagtcg
ctggtgaagcaagacgatccggcagctggtattgcaagcctttttggaaaggatgtcagt
agagcagctcagaagaatgaaacaatcttcgtataa

DBGET integrated database retrieval system