KEGG   Selaginella moellendorffii: SELMODRAFT_268069Help
Entry
SELMODRAFT_268069 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SELMODRAFT_268069
Transfer RNA biogenesis [BR:smo03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    SELMODRAFT_268069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 557 aa AA seqDB search
MAVERRKSTPGRGGVVQQRLSEDEARVRAIAEIVGAMVEGCRSGEDVDLNALKSAACRRY
GLARAPKLVEMIAALPENERDLVLPRLKAKPVRTASGIAVVAVMSKPHRCPHIATTGNIC
VYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYIQARGRVDQLRRLGHSVDKVEYIL
MGGTFMSLPADYRDYFIRNLHDALSGHTSRDVEEAVRYSEHAAIKCIGLTIETRPDYCLS
PHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVGAVADCFCLAKDAGFKVVAHMMPNL
PNVDMERDMESFREFFENPSFRADGLKIYPTLVIRGTGLYELWKTGRYKNYPPEQLVNLV
ARVLSLVPPWTRVYRIQRDIPMPLVTSGVEKGNLRELALMRMEDLGLKCRDVRTREAGIQ
DIHNQIKPEEVELVRRDYCANKGWETFLAYEDTRQDILVGLLRLRKCGPNATCPELLGRC
SIVRELHVYGTAVPVHGRDADKLQHQGYGTLLMEEAERIARKEHRSVKLAVISGVGTRHY
YRKLGYELEGPYMTKRL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggagcgcaggaaatcgacaccgggacggggaggcgtcgtccagcagcggctg
agcgaggacgaggccagggtacgggcaattgcggagattgtaggggctatggtggaagga
tgccgcagcggtgaggacgtcgatctcaatgcgctcaaatccgctgcttgccgccgctac
ggccttgcccgagcgccaaagctcgtggagatgatcgcggcgttgccagagaatgagcgc
gatctcgtcctgcccaggctcaaggccaagcctgtgcgcactgcctctgggattgccgtg
gttgcggtcatgtccaagcctcatcggtgcccacacatcgccacgactgggaatatctgt
gtctactgcccgggaggcccagattcggacttcgaatatagcacacagtcctacactggg
tatgaaccaacgagcatgcgagcaattcgagcaaggtacaatccttatatacaggctcga
ggtcgagtggatcaactcaggcgtctgggccatagcgtggataaggttgaatatatcctt
atgggaggtactttcatgtctttgccagcagactaccgcgactattttatccgaaatctc
catgacgctctgtctggtcacacctctcgagatgtggaggaagccgtgagatactcagag
catgctgccatcaagtgcattggactgaccattgagacgcgtcccgactactgtctgtct
cctcacttgcgccagatgttgtcttatggctgtacgcggcttgagattggggtgcagagc
acgtacgaagatgtcgctcgagatactaaccggggccatacggttggtgctgttgctgac
tgcttttgccttgccaaggacgctggctttaaggtggttgctcatatgatgcctaacctt
ccaaacgtcgatatggaacgggacatggaaagcttccgcgagttttttgaaaatccttcc
tttcgagcggacggcctcaaaatctatccaacgctggttattcgagggacaggtttgtac
gagctatggaagactggaaggtacaagaactatccacctgaacaactcgtcaatctggtt
gcccgagtgttgtctctggtacctccctggactcgggtctatcgcatacaacgtgatatc
cccatgcctcttgtaacgtccggcgtcgagaagggaaacctgcgagagctggcgttgatg
aggatggaggacttgggcttgaaatgtagagatgtcaggacaagagaagctgggattcag
gatatacacaatcaaatcaagcctgaagaagtagagctagtaaggcgtgactactgtgct
aacaaaggctgggagacgtttctggcctatgaagacactagacaggatatactggtgggt
ttactgcgcctgagaaaatgcggtcccaacgctacatgccccgagctgctgggacgatgt
tcgatagttcgcgagctgcacgtttatggaactgcggtgcctgttcacggccgtgacgcc
gacaagctacaacaccagggttatggaactcttttaatggaagaagccgagaggatagct
cgaaaggagcatcgatccgtgaaactggcagtgatatcgggagtgggaactagacactac
tacaggaaactaggctatgagctagaaggtccctacatgacgaaaagattgtaa

DBGET integrated database retrieval system