KEGG   Selaginella moellendorffii: SELMODRAFT_268243Help
Entry
SELMODRAFT_268243 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
smo  Selaginella moellendorffii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smo00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 930 aa AA seqDB search
MDAPGMDSSRAIDRERAAEPRRVSLRFRIPYFTQWGQNLIVTGSHSSLGSWNLHQGLAMV
PHHDEELGELVWTAQLAVREGFQARYSYCVVDDKRNAVRREAGIPRSFVLPDGIPNGSIV
DLYDLWQRVCCHAVLSVTQFLETPSLVALVRRLVLPLPAAMAPSSSKIVKGFMLLEVRVL
LEAGTMNQHLSLRERAIQAGMAAVQSINKTFPTYIYFLKDLRGEVTCELGDGRKLSLDST
WRKPSSLIIVSDGHFKGDLWRGAGLAIPVFSIRTHADVGAGEFLDLKLLVDLAVKSGLRL
LQLLPVNDTSVHGMWWDSYPYSSLSVFALHPLYLSLEAMTERLPQELQDEISQARKKLDL
KDVDYEGTMKTKLSIAKKIFHIEKEAAFNSSKFKTYFDENKHWLEPFAAFCFLRDLFGTA
DHSQWGRFSTFSPEKLEKLVSPSSDHYNLISFTYFLQYHLHSQLTEASEYARNNGVVLKG
DLPIGVDRNSVDTWVFPTLFRMNTSTGAPPDYFDKNGQNWGFPTYNWEEMSKDNFAWWRA
RLTQMSKYFTAYRIDHILGFFRIWELPAHAVTGLTGKFRPSLPLTQEELEAQGIWDFNRL
SEPYVRCHTLQAKFGDAWSEIASKYFDEYEHLCYKFKKEYDTERKILGAVSQLEDSKKQE
QIKGALFDLLRDVVLMRDPEDSRKFYPRFGMEDTSNFKELDEHSKNVLQRLYYDYFYHRQ
EGLWRENALKTLPVLMSSSEMLTCGEDLGMVPACVAPVLNELGLLGLRIQRMPSTPGQEF
GNPLEYEYMTVCAPSCHDCSTMRAWWEDDEGRRIRFYKDYLGMSESPPAQCVPDVARVII
EQHMKSPSMWAIFPLQDLLALKEEYTGRPANEETINDPTNPKHYWRFRTLTHVETLLEDR
ELIFSIKNLVESGGRGTKSLENGFESKMKL
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgccagggatggattcctcgcgcgcgatcgatcgagagagggcagcggagccg
cggcgcgtcagtctgcgcttccggattccatatttcacgcaatggggccagaatctcatc
gtcacaggttcgcattcctcgctcggcagctggaatctccaccagggactggcgatggtt
ccacaccacgacgaggagctcggcgagctggtctggaccgcgcagctggccgtgcgcgag
ggattccaggcgcgctactcgtattgcgttgtggatgacaagcgcaatgcggtcaggagg
gaggctggaattccccggagctttgttcttccggatggaattcccaatggcagcattgtt
gatctatatgatctctggcagagagtttgctgtcacgcagtgctttccgtgacgcaattt
ttagaaactccaagcctagtagcacttgtgaggagactagtactccctctaccggcagct
atggcgccgagctcctcaaagatcgtgaaagggtttatgttactggaagttcgagttctc
ttggaagctgggactatgaatcagcacttaagcttacgagaacgggcgattcaagctggc
atggctgctgtgcaatcgataaacaagactttccccacgtacatctactttctgaaagat
ctccgtggagaagtgacgtgcgagcttggcgatggccgcaagttgtcacttgattctaca
tggagaaaaccatcttccctgatcatagtatcggatggacatttcaagggtgatctgtgg
agaggtgctggccttgccatccctgttttttcaataaggacgcatgcggacgttggagcg
ggcgagtttttggacctgaaactgcttgtggatttagcagtgaagtctggattgaggctt
ctacagttgctaccagttaatgatacttccgtgcacgggatgtggtgggactcgtatcca
tacagctcactttcagtattcgctctacacccgctttatttgagcttggaagccatgact
gaaagattgcctcaagaactccaggacgagatttcccaagcaagaaagaagctcgatcta
aaggatgttgactatgaaggaaccatgaagacaaagctgtctatagctaaaaagattttt
cacatagaaaaagaagccgcgtttaattcctcaaagtttaagacttactttgacgaaaat
aagcactggttagaaccatttgctgctttttgctttttgcgtgaccttttcggcaccgct
gatcattctcaatggggtcgcttttcaacattttcgcctgaaaagctagaaaagcttgtg
tctccttcttctgaccattacaacttgatctctttcacatactttcttcagtatcatctt
cattctcagctcactgaagcgtctgagtacgctcgaaacaatggcgttgttttgaaagga
gatcttcccattggtgtcgatagaaacagtgtggatacatgggtgtttcccacattgttt
cgaatgaatacatcgacgggtgctcctccagactatttcgataagaacgggcaaaactgg
ggatttcctacttacaactgggaagaaatgtccaaagataactttgcatggtggagagct
cgtttaactcagatgtccaagtacttcacggcttacaggattgatcacattctaggattt
tttcgcatctgggagctgcctgcgcacgctgttacaggtcttacgggcaagtttcgaccg
tcgcttccattgacgcaggaagagctggaagcacaaggaatttgggatttcaatcgtctt
agcgaaccatacgttcgatgtcatactttgcaagcaaaatttggagacgcgtggtctgag
attgcgtccaagtattttgatgagtacgaacatttgtgctacaagttcaagaaagagtac
gatacagaaaggaaaattcttggagctgttagtcaacttgaagactcgaaaaagcaggaa
caaatcaagggtgcattgttcgaccttctacgtgacgttgtcttgatgagggacccagag
gacagtagaaagttctatccgagatttggaatggaggacacatcaaatttcaaggagctt
gacgagcacagcaagaacgtcttgcagagattgtactatgactacttctatcacaggcaa
gaaggcctctggcgcgaaaacgctttaaaaacgcttccagttttaatgagctcgtctgaa
atgctaacttgtggagaggaccttggaatggtcccggcatgcgttgctccggttcttaac
gagcttggcctgcttggactgaggatccaacggatgcccagcactccaggccaggagttt
ggcaatccactggaatacgaatacatgacggtctgtgcaccttcgtgtcatgactgctcg
actatgcgtgcttggtgggaggatgacgaaggcagacgaatccgattctacaaagactat
ctgggaatgagtgagtcccctcctgctcagtgcgtaccagatgtggcgcgagttataatc
gaacaacacatgaaatcgccgtcaatgtgggccattttccctctccaggaccttcttgct
ctcaaggaggagtatacaggccgaccggccaacgaggaaactatcaacgatccaacgaat
ccaaagcattactggagattcaggactctcactcatgtggaaactctgctagaagatagg
gagctcattttttcaatcaaaaatctggtggaaagcggtgggagaggtactaaatctcta
gagaatggctttgaaagtaagatgaagctctaa

DBGET integrated database retrieval system